KEGG   Ailuropoda melanoleuca (giant panda): 100467112Help
Entry
100467112         CDS       T01329                                 

Gene name
RHBG
Definition
(RefSeq) Rh family B glycoprotein
  KO
K06580  ammonium transporter Rh
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aml02000]
    100467112 (RHBG)
   04090 CD molecules [BR:aml04090]
    100467112 (RHBG)
Transporters [BR:aml02000]
 Solute Carrier Family (SLC)
  SLC42: Rh ammonium transporter
   100467112 (RHBG)
CD molecules [BR:aml04090]
 Proteins
  100467112 (RHBG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp
Motif
Other DBs
NCBI-GeneID: 100467112
NCBI-ProteinID: XP_002926990
Ensembl: ENSAMEG00000014562
UniProt: G1M7T7
LinkDB All DBs
Position
Un
AA seq 458 aa AA seqDB search
MAESPHRAAGRRLQLPLLCLLLQGATAILFAVFVRYNHETDAALWHWGNHSNADNEFYFR
YPSFQDVHVMVFVGFGFLMAFLQRYGFSSLGFTFLLAAFALQWSTLIQGFLHARHGGHIC
VGVESMINADFCAGAVLISFGAVLGKAGPAQLLLLALLETVLFGVNEFVLLSLLGVKDAG
GSMTIHTFGAYFGLVLSRVLYRPQLEKSKHRQGSVYHSDLFAMIGTIFLWVFWPSFNSAP
TTLGDGQHRTVLHTYYSLTASTLGTFALSALVGEHGRLDMVHIQNAVLAGGVVVGTAGEM
MLTPFGALAAGFLAGSVSTLGYKFFTPILEAKFKVQDTCGVHNLHGMPGVLGALLGVLVA
GLATHEAYGEGLDSVFPLIAAGQRTASSQAMHQLFGLLVTLMFASVGGGLGGILLRLPFL
DSPPDSQCYEDQVYWEVPGELEDEAQGPLRVEEPVTQA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtccccgcaccgcgccgcgggccggcgactgcagctgcctctgctgtgcctc
ctcctccagggcgccaccgccatcctctttgcggtcttcgtccgctacaaccacgaaacc
gacgccgccctctggcactggggcaaccacagtaacgcggacaatgaattttactttcgc
tacccaagtttccaggacgtgcacgtcatggtgttcgtgggcttcggcttcctcatggcc
ttcctgcagcgctacggcttcagcagcctgggcttcaccttcctcctggccgccttcgcc
ctgcagtggtccacgctcatccagggcttcttgcacgccaggcacgggggccacatatgt
gttggcgtggagagcatgatcaacgcagacttctgcgcgggggctgtgctcatctccttc
ggcgccgtcctgggcaaggccgggccggctcagctgctgctcctggccctgctggagacc
gtgctgtttggcgtcaacgagtttgtgctcctcagtctcctgggggtgaaggacgcagga
ggctccatgacaatccacacgttcggggcctacttcgggctggtcctctcgcgggtgctc
taccggccgcagctagagaagagcaagcaccgccagggctccgtctaccattccgacctc
tttgccatgatcggcaccatcttcctgtgggtcttctggcccagcttcaactctgcgccc
accacgctgggggacgggcagcaccgaacagtcctccacacgtactactccctgacggca
agcaccctcggcacctttgccttgtcggccctggtcggggagcacggccggctggatatg
gtccacatccagaacgccgtgctggccggaggggttgtggtggggacagcaggtgaaatg
atgctgacgccctttggggccctggcagctggcttcctggctgggtcggtctccacgctg
gggtacaagttcttcacgcccattcttgaggcgaaattcaaagtccaagacacatgtggt
gtccacaacctccatgggatgcctggggtcctgggagccctcctgggggtcctcgtggct
gggctggccacccacgaagcttatggagaaggcctggacagcgtgtttccgctcatagcc
gcgggccagcgcactgccagctcccaggccatgcaccaactcttcgggctgttggtcaca
ctgatgtttgcttctgtgggtgggggcctcggagggatcctgctgaggctgcccttcctg
gactcccctccagactcccagtgctacgaggaccaggtctactgggaggtgcctggggag
cttgaggatgaagcccagggccctctgcgggtggaggagccagtcacccaggcctaa

DBGET integrated database retrieval system