KEGG   Ailuropoda melanoleuca (giant panda): 100467139Help
Entry
100467139         CDS       T01329                                 

Gene name
GATB, PET112, PET112L
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00970  Aminoacyl-tRNA biosynthesis
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100467139 (GATB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aml03029]
    100467139 (GATB)
Enzymes [BR:aml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100467139 (GATB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100467139 (GATB)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100467139 (GATB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 100467139
NCBI-ProteinID: XP_002913899
Ensembl: ENSAMEG00000018434
LinkDB All DBs
Position
Un
AA seq 557 aa AA seqDB search
MAAPMLRWCCLGRRWVLACVDSGSRHGRGAAIGFTSSRKRGQSSVAQQPLITAQKSRKGE
HKWAAVVGLEIHAQISSNSKLFSGSQVRFAAPPNSLVSFFDASLPGTLPVLNRRCVEAAV
MTGLALSCRINKKSLFDRKHYFYADLPAGYQITQQRLPIAVNGSLAYSVCAGKKPSQVIS
KTVRIKQIQLEQDSGKSLHDELRSQTLIDLNRAGVGLLEVVLEPDMSCGEEAATAVRELQ
LILQALGTSRANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSARFLAKAIDSEIERQI
HELENGREILNETRSFDYKLGCTMPMRDKEGKQDYRFMPEPNLPPLLLYDTASLPPGADP
QQVINIDWIRERLPDLPSETREKLIQQYGMLPEHSFALLNEVGLLEFFQNVIKETRAEPK
KVTSWVLNIFLGFLKQQNLAVNESPVTPTALAELLNLLDRKAISSSAAKQVFEELWRSKG
KTPSQIVSEKQLELMQDEEALERVCHTVMEGHPQVVMDMKRGNSRAINKLIGLVRKATLS
RADPTVIKEILEKKLSS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccatgcttcgctggtgctgtctcggaaggcgttgggttttagcctgcgtt
gacagcggttctcgccatggaagaggggctgcgattgggttcacgtccagcaggaaaagg
ggacagagctccgtggctcagcagcccctcatcaccgcccagaagtcaaggaaaggtgaa
cacaaatgggcagctgtggtaggtttggaaattcatgcccagatctcctccaactctaaa
ctcttctctggatctcaagtccgttttgcagcacctccaaattctttggtatcttttttt
gatgcatctctgcctggaactctgccggttctcaacaggaggtgcgtagaagcggccgtg
atgacaggcctggcactgagctgccgcatcaacaagaagtccttgtttgacaggaagcac
tacttctatgcagacctccctgcaggctaccaaattacccagcaaagactcccaattgct
gtgaatgggagcttagcgtacagcgtctgtgcggggaagaagccgagtcaggtgatcagc
aagaccgtgaggatcaagcagatccagctggagcaggacagtggcaaaagcctccatgac
gagctgcggtctcagacactcatcgatttgaacagggcaggagttggccttctggaagtg
gtgctggagcccgacatgtcctgtggagaggaggcagcaacagccgtcagggagctgcag
ctgatccttcaggccctggggaccagccgggcaaatatggcagagggccagttgagagtg
gatgccaatatatccgtgcatcatcccggagagcctttgggtgttcgaactgaagtgaag
aatctcaacagtgccaggttcttggccaaagcaatagactctgaaattgagagacaaatc
catgaacttgagaatggacgtgaaattctgaatgaaacgcgctcgtttgactacaagctg
gggtgcaccatgccgatgagagacaaagaaggaaaacaagactacaggtttatgcccgaa
cccaatctgcctcccctgctgctctatgacaccgcgtctctgcctcctggcgcagaccca
cagcaagtgatcaacattgactggattcgggagcggctccctgatctccccagtgagacc
cgggagaagctcattcaacagtacgggatgctgccagagcacagcttcgccttactgaat
gaagttggcctactggagttcttccaaaatgtgataaaagaaactagggcagagccaaaa
aaagtaactagttgggtcctcaacatttttctgggttttttaaagcaacagaaccttgct
gtcaatgagagtcctgtcacacctactgcgctggcggaactgctcaacctgctggaccga
aaagccatctcttcatcagcagcgaaacaggtgtttgaggagctgtggcggagtaaaggg
aagactccatcgcagatcgtttcagaaaagcagcttgaactgatgcaggatgaagaggca
ctggaacgggtctgccacaccgtgatggaggggcatcctcaagtggtaatggacatgaag
aggggaaactccagagctataaacaaactgattgggttggtccgaaaagcgactctgagc
cgagcagacccgactgtgataaaggagatcctggagaagaagctgtcatcatga

DBGET integrated database retrieval system