KEGG   Ailuropoda melanoleuca (giant panda): 100467146
Entry
100467146         CDS       T01329                                 

Gene name
CHEK2
Definition
(RefSeq) serine/threonine-protein kinase Chk2
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04218  Cellular senescence
aml05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100467146 (CHEK2)
   04115 p53 signaling pathway
    100467146 (CHEK2)
   04218 Cellular senescence
    100467146 (CHEK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100467146 (CHEK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100467146 (CHEK2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100467146 (CHEK2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100467146 (CHEK2)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   100467146 (CHEK2)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100467146 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo Pkinase_fungal YrbL-PhoP_reg Haspin_kinase LEA_6 RIO1 APH
Other DBs
NCBI-GeneID: 100467146
NCBI-ProteinID: XP_011218533
Ensembl: ENSAMEG00000008484
LinkDB
Position
12
AA seq 544 aa
MSRETDGECQQSHGSSACSQPQGGFSQSQGISSQTHGSSSQSQGTSSSTSTAPTSSQSSH
SSSGTLSSLDTVSTQELCSIPEDQEPEEPVPAPWARLWALQDGFPNLECVNDNYWFGRDR
SCDYCFDEPLLKRTDKYRTYSKKHFRIFREMGPKNSYIAYIEDHSGNGTFVNRELVGKGR
RLPLNNNSEIALSVWSNKVFVFFDLTVDDQSVYPKELRDQYILSKTLGSGACGEVKLAFE
RKTCKKVAIKIISKRKFAIGSESGADPPPNVETEIEILKKLDHPCIIKIKDFFDAEDYYI
VLELMEGGELFDRVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQK
EDCLIKITDFGQSKILGETSLMRTLCGTPTYLAPEVLNSFGTAGYNRAVDCWSLGVILFI
CLSGYPPFSEHKTQVSLKDQITSGKFNFIPEVWTEVSEKALDLVKKLLIVDPKVRFTTEE
ALRHPWLQDEDMKRKFQKLLFEETKSTALPQLPAQPSTSRKRRLEGEAEDADTTKRLAVC
AAVS
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtctcgagagacggatggggagtgtcagcagtcccatggcagtagcgcctgttcacag
ccccaaggcggcttctcacagtctcaaggcatctcctcccagacgcacggctcctcgtca
caatctcaaggaacgtccagctccaccagcacagcacccacatccagccagtcctctcac
tccagctcggggacgctgagctccttagacacagtgtccacccaggaactctgttctatt
cctgaggaccaggaacccgaggagcctgtccctgccccttgggctcgattatgggccctt
caggatgggttccccaatcttgagtgtgttaatgacaactactggtttgggagagataga
agctgtgactactgctttgatgagccactgctgaaaagaacggataaataccggacttac
agcaagaagcactttcggattttcagagaaatgggtcctaaaaactcttacatcgcatac
atagaagatcacagtgggaatggaacctttgtaaatagagagctggtagggaaaggaaga
cgccttcctttgaataacaattctgaaattgcactgtcagtgtggagtaataaagttttt
gtattttttgatctgactgtagatgatcagtcagtttatcctaaggaattaagagaccaa
tacatcctgtcaaaaactcttggaagcggtgcctgtggtgaagtgaagctagcttttgag
aggaaaacatgtaagaaagtagccataaaaatcatcagcaaaaggaagttcgctattggc
tctgagagtggggcagatccacctcccaatgttgaaacagaaatagaaattttgaaaaaa
ctagatcatccttgtatcatcaagattaaagacttttttgatgccgaagattattatatt
gttttggaattgatggaaggaggagagcttttcgacagggtggtggggaataagcgcctc
aaagaagctacgtgtaaactctatttttaccagatgctcctggctgtacagtaccttcat
gaaaacggtattatacatcgggacttaaaaccagagaatgttctactctcatctcaaaaa
gaggactgtcttataaagattactgattttgggcagtctaagattttgggggagacctct
cttatgagaactttatgtggtactcccacctacctggctcctgaggttcttaattccttt
gggactgctggatataaccgagctgtggattgctggagtttaggagttattctttttatt
tgccttagtgggtatccacctttctctgagcataagactcaggtgtctttgaaggatcag
atcaccagtggaaaattcaatttcattcctgaagtctggacagaggtctcagaaaaggct
ctggaccttgtcaagaagttgttgatagtggatccaaaggtgcgttttacgacagaagaa
gctttaagacacccgtggcttcaggatgaagacatgaagagaaaatttcagaaattactt
tttgaagaaacaaagtcaacggctctaccccaactcccagcccagccttccacgagtcga
aagcggcgtcttgaaggggaagcagaggatgctgacaccacaaagcgcctggctgtgtgt
gctgctgtgtcgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100467858
Entry
100467858         CDS       T01329                                 

Gene name
CHEK1
Definition
(RefSeq) serine/threonine-protein kinase Chk1 isoform X2
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04218  Cellular senescence
aml05166  Human T-cell leukemia virus 1 infection
aml05170  Human immunodeficiency virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100467858 (CHEK1)
   04115 p53 signaling pathway
    100467858 (CHEK1)
   04218 Cellular senescence
    100467858 (CHEK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100467858 (CHEK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100467858 (CHEK1)
   05170 Human immunodeficiency virus 1 infection
    100467858 (CHEK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100467858 (CHEK1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100467858 (CHEK1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100467858 (CHEK1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100467858 (CHEK1)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100467858 (CHEK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 100467858
NCBI-ProteinID: XP_002924041
LinkDB
Position
8
AA seq 497 aa
MPEFRILACGLKPWIKYGCGVMAVPFVEDWDLVQTLGEGAYGEVQLAVNRRTEEAVAVKI
VDMKRAIDCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPD
IGMPEQDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRHNN
RERLLNKMCGTLPYVAPELLKRKEFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYS
DWKEKKTYLNPWKKIDSAPLALLHKILVENPSVRITIPDIKKDRWYNKPLKKGAKRPRVT
SGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLV
QGISFSQPTCPDHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEK
LGYQWKKSCMNQVTVSTTDRRNNKLIFKVNLVEMDEKILVDFRLSKGDGLEFKRHFLKIK
GKLNDVVSSQKVWLPAT
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgccagaatttcgaatacttgcttgtggtttaaagccttggataaaatacggctgtgga
gtcatggcagtgcccttcgtggaagactgggacttggtgcaaaccctgggagaaggtgcc
tatggagaggttcaacttgctgtgaatagaagaactgaagaagcagttgcagtcaagatt
gtagacatgaagcgtgccatagactgtccagaaaatattaagaaagagatctgtatcaat
aaaatgttaaatcatgagaatgtagtgaaattctatggtcacaggagagaaggcaatatc
cagtatctatttctggagtactgtagtggaggggaactttttgacagaattgagccagac
ataggcatgcctgaacaagatgctcagaggttcttccatcaactcatggcaggggtggtt
tatctgcatggtattgggataactcacagggatattaagccagaaaatctcctgttggat
gaaagggataacctgaaaatctctgactttggcttggcaacagtgtttcggcataataat
cgtgaacgtttattgaacaagatgtgtggtactttaccttatgttgctccagaacttcta
aagagaaaagaatttcatgcagaaccagttgatgtttggtcctgtggaatagtactcacg
gcaatgttggctggagaattgccatgggaccagcccagtgacagttgtcaggaatattct
gattggaaagagaaaaaaacatacctcaacccttggaaaaaaattgattcagctcctcta
gctttgctccataaaatcttagttgagaatccatcagtaaggattaccatcccagacatc
aaaaaagatagatggtacaacaaaccactcaagaaaggggcaaagaggccccgagtcact
tcaggtggtgtatcagagtctcctagtgggttttctaagcacattcaatccaatttggac
ttctcaccagtgaacagtgcctctagtgaagaaaatgtgaagtactccagttcccagcca
gaaccacggacaggtctttccttatgggacaccagcccttcctatattgataaactggta
caagggatcagtttttcccagcccacatgccctgatcatatgctcctgaacagtcagtta
cttggcaccccaggatcctcacagaacccttggcagcgcttggttaaaaggatgacacgg
ttttttaccaaattggatgcagacaaatcttatcaatgcctgaaagagacttgtgagaaa
ttgggctatcaatggaaaaagagttgtatgaatcaggttactgtatcaacaactgatagg
agaaacaataaactgattttcaaagtgaatttggtagaaatggatgagaagatcttggtc
gactttcggctttctaagggtgatggattagaattcaagagacacttcctgaagattaaa
gggaagctgaatgatgttgtgagcagccagaaggtttggcttcctgccacatga

DBGET integrated database retrieval system