KEGG   Ailuropoda melanoleuca (giant panda): 100467233
Entry
100467233         CDS       T01329                                 

Gene name
RCHY1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1 isoform X1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04115  p53 signaling pathway
aml04120  Ubiquitin mediated proteolysis
aml05162  Measles
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100467233 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100467233 (RCHY1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100467233 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aml04121]
    100467233 (RCHY1)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100467233 (RCHY1)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100467233 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 Prok-RING_4 zf-C3HC4_3 zf-RING_11 zf-rbx1
Other DBs
NCBI-GeneID: 100467233
NCBI-ProteinID: XP_002919200
Ensembl: ENSAMEG00000014376
UniProt: D2HBB4
LinkDB
Position
11
AA seq 261 aa
MAASAREDGARSQKQGRRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEV
QCINCEKIQHAQQTCEECSTLFGEYYCSICHLFDKDKKQYHCENCGICRIGPKEDFFHCL
KCNLCLAMNLQGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG
YRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKC
NICESYNTAQAGGCRISLDQQ
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcggcctcggcgcgggaagatggcgcccgcagccaaaagcaagggcggcggggctgc
gagcactatgacagaggatgtctcctgaaggcaccttgctgtgacaaactttatacttgt
cggttgtgtcatgataacaatgaagatcatcagctagatcgctttaaagtaaaggaagtg
cagtgcatcaactgtgaaaaaattcaacacgcccaacagacttgcgaagaatgtagcaca
ttgtttggggaatattattgcagtatatgccatctctttgacaaagacaagaagcagtat
cattgtgaaaactgtggaatttgtaggattggtccaaaggaagactttttccactgtttg
aaatgtaacttatgcctagctatgaatctccaaggaaagcacaagtgtattgaaaatgtt
tccaggcagaattgtccaatatgtttggaggacattcacacatcccgtgttgttgctcat
gtcctgccatgtggacatcttttacatagaacgtgttatgaagaaatgttgaaagaaggc
tacagatgcccactgtgcatgcactctgctttagacatgacgcggtactggagacagctg
gatgatgaggtagcacagactcctatgccatcagaatatcagaacatgactgtggatatt
ctctgcaatgattgcaatgggagatctacagtccagttccatattttaggcatgaaatgt
aatatttgtgaatcctacaatactgctcaagctggaggatgtagaatttcactagatcag
caatga

DBGET integrated database retrieval system