KEGG   Ailuropoda melanoleuca (giant panda): 100467304Help
Entry
100467304         CDS       T01329                                 

Gene name
RHAG
Definition
(RefSeq) Rh-associated glycoprotein
  KO
K06580  ammonium transporter Rh
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aml02000]
    100467304 (RHAG)
   04090 CD molecules [BR:aml04090]
    100467304 (RHAG)
Transporters [BR:aml02000]
 Solute Carrier Family (SLC)
  SLC42: Rh ammonium transporter
   100467304 (RHAG)
CD molecules [BR:aml04090]
 Proteins
  100467304 (RHAG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp
Motif
Other DBs
NCBI-GeneID: 100467304
NCBI-ProteinID: XP_002915481
Ensembl: ENSAMEG00000008815
LinkDB All DBs
Position
Un
AA seq 416 aa AA seqDB search
MKLSFPFTAIVLEISMIVLFGFFVKYETEQNAIQQQLNITNSTKVDRSLELHPLFRDVHV
MIFAGFGFLMTFLRKYGFSSVGINLLIAALGLQWGTFIQGILHHHGQTIYIGIKNMINAD
FSTATVLISFGAVLGKISPAQMLIMTIIEIAVFAGNEYVVGEIFQASDIGASMTIHAFGA
YFGLAVAGVLYRPDLRRGHEKEESVYHSDLFAMIGTLFLWMFWPSFNSAIAETTEQQYMA
IINTYFSLVACVLTAYAFSSLVGKRGKLDMVHIQNATLAGGVAVGTCADMEIHPYGAMII
GSIAGIVSVLGFKFLTPCLTDKLKIHDTCGVHNLHGLPGVVGGLASIVAIVFRASKASSV
VMQAAALGSSLGTAIVGGLITGLILRFFVCGLSSTEFFFDDSVYWEVPRGREVDDE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctcattccccttcacggccattgtactggagatttctatgattgttttattt
ggattttttgtcaagtatgaaacagagcagaatgctatccaacaacagctcaacatcacc
aactcaacaaaagtggacagatcccttgagttacatcctttattccgagatgtgcatgta
atgatatttgctgggtttggcttcctcatgaccttcctgagaaaatatggcttcagtagt
gtgggcatcaatctactcattgctgctttgggcctgcaatggggcacttttattcaggga
atcctgcaccaccatggacagacaatttacattggaatcaaaaacatgataaatgcagac
ttcagtacagccacagtcctgatttcttttggagccgtcctgggaaaaataagcccagcc
caaatgttgatcatgacaataatagaaatcgctgtctttgctggtaatgaatatgtggtt
ggtgagatatttcaggcctctgacattggagcatcaatgacgatccatgcttttggggcc
tactttggcttggcggtagcaggtgtcctatatcggccagacttgagaagggggcatgag
aaggaggagtctgtgtaccactcagatttgtttgcaatgattgggactcttttcctatgg
atgttttggcccagctttaattcagccattgctgaaactacagagcaacagtacatggcc
atcataaatacatacttctctcttgttgcctgcgtgctcacagcctatgcattttccagc
ctcgtggggaagagaggcaagctcgatatggttcacattcagaatgcaaccctggctgga
ggagttgctgtgggcacgtgtgcagacatggagattcacccatacggtgctatgatcatt
ggaagcattgcgggaattgtctctgtgcttgggttcaagtttctgactccatgtcttact
gataaactgaagatccatgatacatgcggtgttcataacctgcatggcttacctggtgtg
gtaggaggcctcgcaagcattgtggcgatagtcttccgagcatctaaggcgtctagcgtg
gtcatgcaggcagctgccctgggttcttcgcttggaacagcaattgttggagggctgatc
acaggtttaattctcaggttctttgtctgtggactgtcatctacggaattcttctttgat
gattccgtttattgggaggtccccagggggagagaagttgacgatgaatga

DBGET integrated database retrieval system