KEGG   Ailuropoda melanoleuca (giant panda): 100467317
Entry
100467317         CDS       T01329                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X1
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05200  Pathways in cancer
aml05216  Thyroid cancer
aml05223  Non-small cell lung cancer
aml05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100467317 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467317 (RET)
   05230 Central carbon metabolism in cancer
    100467317 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100467317 (RET)
   05223 Non-small cell lung cancer
    100467317 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100467317 (RET)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100467317 (RET)
Protein kinases [BR:aml01001]
 Receptor tyrosine kinases (RTK)
  RET family
   100467317 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD4 RET_CLD3 Pkinase Cadherin RIO1 Pkinase_fungal FOXP-CC
Other DBs
NCBI-GeneID: 100467317
NCBI-ProteinID: XP_034518797
Ensembl: ENSAMEG00000016880
LinkDB
Position
6
AA seq 875 aa
MVPFPVTVYDEDDSAPTFLGGFDTASAVVEFKRKEGTVVATIRVFDADVVPASGELLRRY
TSTLLPGEAWALQTFRIEHSPNETLVQANGSFVRATVHDYRLVLNRSLPISESRSLQLAV
LVNDSDFQGPGEGVLLLHFNVTVLPVSLHLPSAYSFTVSRRARRFAQIGKVCVDNCQEFS
GIHVQYKLQLSSTNCSVLGVVTSAEDTTGTLFVNDTEALQRLDCSQLQYTVVAADRPTRR
QTQAPLVVTVEGTYVAEEPGCPLSCAVSKRRPECEECGGLGSLTGRCEWRQGDGKGITRN
FSTCSPSIKTCPDGHCDAVESRNVNICPQDCLRKQPLGLQVQGPGVGGGSIIGGHEPGDR
WGIKAGFGICNCFPEEKKCFCEPEDSQDPLCDELCRMVIAAAVLFSFIISMLLSTFCIHR
YHKNAHKPPIASAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKIPEDPKWEF
PRKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASPSELRDLLSEFNLL
KQVNHPHVIKLYGACSQDGPLFLIVEYAKYGSLRGFLRESRKAGPGYVGSGGSRSSSYLD
NPEERALTMGDLISFAWQISRGMRYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDV
YEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPER
LFNLLKTGYRMERPDNCSEEMYGLMLQCWKQEPDKRPVFADISKDLEKMMVKNRDYLDLA
ASTPSDSLLYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPEESPVPLTR
ADGTNTVCPRYANDSVYANWMVSPSAAQLTDAFDS
NT seq 2628 nt   +upstreamnt  +downstreamnt
atggtgcccttccctgtgaccgtgtacgatgaggacgactcggcgcccaccttcctcggg
ggcttcgacaccgccagcgctgtggtggagttcaagaggaaggagggcaccgtggtggcc
acaatacgtgtcttcgacgcagatgtggtgccagcatctggggagctcctgaggagatac
acaagcacactactccctggagaggcctgggccctccagacattccgcatcgagcactca
cccaacgagaccttggtccaggccaatggcagttttgtgcgggcaactgtgcacgactac
aggctggttctcaaccggagcctccccatctcagagagccgctccctgcagctggccgtg
ctggtcaatgactcggacttccagggccccggggagggcgtcctgctcctccacttcaac
gtgaccgtgctgcctgtcagcctgcacttacccagcgcctactccttcactgtgagcagg
cgggcccgccgctttgcccagattgggaaagtctgtgtggacaactgccaggagttcagc
ggcatccacgtgcagtacaagctgcagctctccagcaccaactgcagtgtcctgggggtg
gtcacctcagccgaggacaccacggggaccctgttcgtgaatgacacggaagccctgcag
cggctcgattgttctcaactccagtacacggtggtggctgccgaccggccaacccgcagg
cagacccaggccccgctggtcgtcaccgtggaggggacgtatgtggctgaggagccaggc
tgccccctgtcctgtgcagtcagcaagaggcggcctgagtgtgaggagtgcggcggcctg
ggctctctgacgggcaggtgcgagtggagacagggagatggcaaagggatcacgaggaac
ttctccacctgctcccccagcatcaagacctgccccgatggccactgtgatgctgtggag
agcagaaatgtcaacatctgcccccaggactgcctccgtaagcaaccactgggcctgcaa
gttcaaggccctggcgtggggggcggcagcatcattggtgggcacgagccaggggaccgc
tgggggataaaagctggcttcggtatctgcaactgtttccctgaagagaagaagtgcttc
tgtgagcctgaagacagccaggacccactgtgtgatgagctctgccgcatggtgattgcg
gcggccgtgctcttctccttcatcatctccatgctgctctccaccttctgcatccaccgc
taccacaagaacgcccataagccgcccatcgcctccgctgagatgaccttccgccggccg
gcccaggccttcccagtcagttactcctcgtcgggtgcccgccggccctccctggactcc
atggagaaccaggtctctgtggatgccttcaagatcccggaggatccaaagtgggaattc
cctcggaagaacttggttcttggaaaaactctgggagaaggtgaatttggaaaagtggtt
aaggcaaccgccttccggcttaaaggcaaagcagggtacacgaccgtggccgtgaagatg
ctgaaagagaacgcctccccaagcgagctgcgggacctgctgtcagagttcaacctcctg
aagcaggtcaaccacccacatgtcatcaagctatacggggcctgcagccaggatgggcca
ctcttcctcattgtggagtacgccaagtacggctccctgcggggattcctccgagagagc
cgcaaggctgggccgggctacgtgggcagtggaggcagccgcagctccagctacctggac
aaccctgaggagcgggccctgaccatgggcgacctcatctccttcgcctggcagatctct
cgggggatgcggtacctggcggagatgaagcttgtccatcgggacttggctgccagaaat
gtcctggtagccgaggggcggaagatgaagatttcggattttggcctatcccgagatgtt
tatgaagaggattcctatgtgaagaggagcaagggtcggattccagtcaaatggatggca
attgagtctctttttgatcatatttacaccacccagagtgatgtgtggtccttcggtgtc
ctgctgtgggagattgtgactctggggggcaacccctacccggggattcctccggaacgg
ctcttcaaccttctgaagacaggctaccggatggagaggcctgacaactgcagcgaggag
atgtatggtctaatgctgcagtgttggaagcaggaaccagacaagaggccggtgtttgct
gacatcagcaaagacctggagaagatgatggttaagaacagagactacttggacttggcc
gcgtccaccccatctgactccctgctttacgatgacggcctctcagaggaggagacgccc
ctggtggactgtaataatgctcccctccctcgagcccttccctccacgtggattgaaaac
aaactctatggcatgtcagacccgaactggcctgaagagagtcctgtaccactcacgaga
gctgatggcactaacactgtgtgtccaagatatgcaaatgatagtgtatatgctaactgg
atggtttcaccctcagcggcacaattaacggacgcgtttgatagttaa

KEGG   Ailuropoda melanoleuca (giant panda): 100474916
Entry
100474916         CDS       T01329                                 

Gene name
NCOA4
Definition
(RefSeq) nuclear receptor coactivator 4 isoform X1
  KO
K09289  nuclear receptor coactivator 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04216  Ferroptosis
aml05200  Pathways in cancer
aml05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100474916 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100474916 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100474916 (NCOA4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 100474916
NCBI-ProteinID: XP_011231922
Ensembl: ENSAMEG00000007503
LinkDB
Position
6
AA seq 625 aa
MSTSQDQSGCSSTREPLLRCCDARRDLELAIGGVLRAEQQIKDNLQEVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQTQQLYWLLGQFNCLIHQLECTQNKDLANQVSV
CLERLGNLTLKPEDSTVLLFEADTTALRQTITTFGSLKTIQIPEHLIAHANSSNLGSFLE
KRAYIPLPEQKSASSTTAVCLSEWLLGSKPANGRQAPYIPSTNLQDWLTQKQTLENSQTS
ARACSFFSNVWGNLKGLENWLYKSQQQEVPEKPTYQKCNSHSTTSSHAIEIEKVGDQDLL
DQDEMDLSDWLVTPQESRKLEKPGNSSCETSEKLKLLLQVFQEPYSVNDWLVKPDSCTNC
RGNQPKGVEIENLGNLKCLNDHLEAKKPLSIPSLITEDWLVQNHQDTYKVEEVCKANEPC
TSFAECVCDENCEKEALCKWLLKKEGKDKNGMPVEPNPEPEKCIDSLSVWLCPSRKEATQ
QAKMSKAVAPSRIADSFQVIRNSPLSEWLITPTCKEGCPKEVPSAEDRAGKQKLTNPVAT
SWCPFNTADWVLPGEKMGNLSHLSSGEDKWLLRKKAKEVLLNSPLQEERNFPQDRYGLPA
VCDLFACMQLKVDKEKWLYRTPLQM
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgagcacctcacaggaccagagcggctgctccagtactagagaaccccttttgaggtgt
tgtgatgcacggagggacttggagcttgctattggtggagttctccgggctgaacagcaa
attaaagataacttgcaagaggttaaagcccagattcacagctgcataagccgtcacctg
gaatgccttcgaagccgtgaggtgtggctgtatgaacaggtagatctcatctatcagctt
aaagaggagacacttcagcagcagacccaacagctctactggttactgggccagttcaat
tgtcttattcatcagctggagtgcacccaaaacaaagatctagccaatcaagtctctgtg
tgcctggagagactgggcaatttgaccctcaaacccgaagattcgactgtcctattgttt
gaagcagacacaactgctctgcgccagaccatcaccacatttggatccctcaagaccatc
caaattcctgagcacctgattgctcatgctaattcatcaaatcttgggtctttcctggag
aaaagagcttatatcccattgccagaacagaagtcagcatccagcaccacggctgtctgt
ctcagcgaatggcttcttggaagcaaacctgccaatggtcgtcaggctccttacatcccc
agcactaacctccaggactggctcacccaaaagcagaccttggagaatagtcagacttct
gccagagcctgcagtttcttcagtaatgtctggggcaacctaaagggcttagaaaactgg
ctctacaagagtcagcaacaagaggttcctgaaaaaccaacttaccaaaagtgtaacagt
cattctaccaccagttctcatgctattgaaattgaaaaggttggagaccaggaccttctt
gatcaagatgagatggacctttctgattggctggtgactcctcaggaatcccgtaagctg
gagaagcctgggaatagcagctgtgaaaccagtgagaagttgaagctcctgttgcaggtg
ttccaggagccctatagtgtgaatgattggcttgtcaagcccgattcctgtaccaattgt
cggggcaaccagcccaagggtgtggagattgaaaacctgggcaatctgaagtgcctgaat
gaccacttagaagccaagaaacccttgtccattcccagcctgattactgaggattggctt
gtccagaaccatcaggacacatacaaagtagaggaggtatgcaaagccaacgagccctgt
acaagctttgcagagtgtgtgtgtgatgagaactgtgagaaggaagctctgtgtaaatgg
cttctgaagaaagaaggaaaagacaaaaatggtatgcctgtggaaccaaatcctgagcct
gagaaatgtatagattccctgagtgtgtggctctgtccttccagaaaagaggcaacacaa
caagctaagatgtcaaaggcagtggctccttctagaattgccgattccttccaagtcata
aggaacagtcctttgtcagagtggctcatcacacccacatgcaaagaaggttgtcccaaa
gaagtgcctagtgctgaagacagagctggcaagcaaaagcttacgaacccggtggccact
tcctggtgtccctttaacacagctgactgggtcttgccaggagagaaaatgggaaacctc
agccatttatcctcaggagaagacaagtggctacttcgaaagaaggccaaggaagtatta
cttaactcacccctacaggaggaacgtaactttccccaagaccgttatggcctcccagca
gtttgtgacctctttgcctgtatgcagcttaaagttgacaaagaaaagtggttgtatcga
actcctctacagatgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100476794
Entry
100476794         CDS       T01329                                 

Gene name
CCDC6
Definition
(RefSeq) LOW QUALITY PROTEIN: coiled-coil domain-containing protein 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05200  Pathways in cancer
aml05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100476794 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100476794 (CCDC6)
SSDB
Motif
Pfam: DUF2046
Other DBs
NCBI-GeneID: 100476794
NCBI-ProteinID: XP_002915143
Ensembl: ENSAMEG00000003392
LinkDB
Position
6
AA seq 476 aa
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGSGGGGGGGGKSGGIVISPFRLEE
LTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFK
KIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKI
KKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQP
VSAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMR
EENLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTP
SPSSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGASHGITRPSPRRSN
SPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPAAPSAATAQPAPSQHPAHPSSQP
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcggacagcgccagcgagagcgacacggacggggcggggggcaacagcagcagctcg
gccgccatgcagtcctcctgctcgtcgacctcgggcggcggcggtggcggtagcggcggg
ggaggtggaggcggtgggaagtcggggggcattgtcatctcgccgttccgcctggaggag
ctcaccaaccgcctggcctcgctgcagcaggagaacaaggtgctgaagatcgagctggag
acctacaaactcaagtgcaaggcgctgcaggaggagaaccgcgacctgcgcaaagccagc
gtgaccatccaagccagggctgagcaagaggaagaattcatcagtaacactttattcaag
aaaatccaggctttgcagaaggagaaagaaacccttgctgtaaattatgagaaggaagaa
gagtttctcactaatgagctctccagaaaattgatgcagttgcagcatgagaaagctgaa
ctggaacagcatctcgaacaggagcaggaattccaggtcaacaaactgatgaagaaaatt
aaaaaactggagaatgataccatttctaagcagcttacattagaacagttgagacgagag
aagatcgaccttgaaaatactttggaacaagaacaagaagcgctagttaatcgtctctgg
aaaaggatggacaaacttgaagctgaaaagcgaatcctgcaggagaaattagaccagccg
gtctctgctccgccgtcgcctagagacatctccatggagatagactctccagaaaacatg
atgcgccacatcaggtttttaaagaatgaagtggagaggctgaagaagcagctgagagcc
gctcagttacagcattctgagaagatggcgcagtacctggaggaggagcgccacatgcgg
gaggagaacctgcggctgcagagaaagctgcagcgagagatggagagaagggaagccctg
tgtcggcagctgtccgagagcgagtccagcctggaaatggatgacgaaaggtattttaac
gagatgtctgcgcaaggattaagacctcgcactgtgtccagcccgatcccttacacacct
tctccaagttcaagcaggcctatatcaccgggtctgtcatatgcaagtcacacagttggt
ttcacgccaccaacttcactgactagagccggaatgtcttactacaattccccgggcctg
catgtgcagcacatgggagcctcccatggcatcacaaggccttcaccacggagaagcaac
agtcctgacaaattcaaacggcccacgccgcctccgtctcccaacacacagaccccggtc
cagccccctccgcctccacccccaccacccatgcagcctgcagccccctcggcagccacc
gcgcagcctgccccttcgcagcatccggcgcacccctcctcccagccttaa

DBGET integrated database retrieval system