KEGG   Ailuropoda melanoleuca (giant panda): 100467420
Entry
100467420         CDS       T01329                                 

Gene name
CDKN2D
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor D isoform X2
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100467420 (CDKN2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100467420 (CDKN2D)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 100467420
NCBI-ProteinID: XP_002921415
Ensembl: ENSAMEG00000011370
UniProt: D2HGY2
LinkDB
Position
4
AA seq 166 aa
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPTIALEL
LKQGASPNVQDTTGTTPAHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVREGHT
AVVSFLATESDLHHRDARGLTPLELAQGIGAQDLMDILQGHAVVLL
NT seq 501 nt   +upstreamnt  +downstreamnt
atgctgctggaggaggtccgcgccggcgaccggctaagcggggccgcggcccgaggcgac
gtgcaggaggtgcgccgccttctgcaccgcgagctggtgcaccctgacgccctgaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggcagccccaccattgccttggagctc
ctcaaacaaggtgccagccccaatgtccaggacaccaccggcactactccagcccatgat
gcagcgcgcactggattcctggacaccctgaaggttttggttgagcacggtgctgatgtc
aacgtgcctgatggcactggggcgctccctatccatctggcagtacgagagggccacacg
gctgtggtcagcttcctggctaccgagtctgatctccatcacagggacgccaggggactc
acacccctggagttggcccaggggataggggctcaggatctcatggacatactgcagggg
cacgcggtggtactgctgtga

DBGET integrated database retrieval system