KEGG   Ailuropoda melanoleuca (giant panda): 100467653
Entry
100467653         CDS       T01329                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X5
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04720  Long-term potentiation
aml04724  Glutamatergic synapse
aml04728  Dopaminergic synapse
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100467653 (PPP3CA)
   04310 Wnt signaling pathway
    100467653 (PPP3CA)
   04370 VEGF signaling pathway
    100467653 (PPP3CA)
   04020 Calcium signaling pathway
    100467653 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    100467653 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100467653 (PPP3CA)
   04218 Cellular senescence
    100467653 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100467653 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    100467653 (PPP3CA)
   04660 T cell receptor signaling pathway
    100467653 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    100467653 (PPP3CA)
   04659 Th17 cell differentiation
    100467653 (PPP3CA)
   04662 B cell receptor signaling pathway
    100467653 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100467653 (PPP3CA)
   04921 Oxytocin signaling pathway
    100467653 (PPP3CA)
   04924 Renin secretion
    100467653 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100467653 (PPP3CA)
   04728 Dopaminergic synapse
    100467653 (PPP3CA)
   04720 Long-term potentiation
    100467653 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100467653 (PPP3CA)
   04380 Osteoclast differentiation
    100467653 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100467653 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100467653 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    100467653 (PPP3CA)
   05020 Prion disease
    100467653 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    100467653 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100467653 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100467653 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100467653 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    100467653 (PPP3CA)
   05163 Human cytomegalovirus infection
    100467653 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100467653 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100467653 (PPP3CA)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100467653 (PPP3CA)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100467653 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 100467653
NCBI-ProteinID: XP_011219643
Ensembl: ENSAMEG00000008779
LinkDB
Position
11
AA seq 511 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcatcggcttacagcaaaagaagtgtttgataatgatggaaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggagggcaggctggaagagagcgtt
gcattgagaataataacagagggggcttccattcttcgacaggaaaagaatttgctggat
attgatgcaccagtcacagtttgtggggacatccatggacaattctttgacttgatgaag
ctttttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acgtttaaacaagaatgtaaaataaagtattcagaacgcgtatatgacgcctgtatggat
gcctttgactgcctgcctctggctgctctgatgaaccagcagttcctgtgtgtccacggg
ggtttatctccagagattaacactttagatgacatcaggaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgtgatatcctgtggtcagacccgctggaggattttgga
aacgagaagactcaggaacatttcactcacaacacagtcagggggtgttcgtacttctac
agttacccggctgtgtgtgaattcttacagcacaataatttgttatctatactccgagcc
catgaagcccaggatgcagggtatcgcatgtacaggaaaagccaaacgacaggcttccct
tctctaattacaattttctcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaacgtcatgaatatcaggcaattcaactgttctcctcacccc
tactggcttccaaatttcatggatgttttcacttggtccctgccatttgttggggaaaaa
gtgaccgagatgctggtaaatgtcctcaacatctgctcagatgatgaactggggtcagaa
gaagatggatttgatggagcaacagccgcagcccggaaggaggtgataaggaacaagatc
cgagcaataggcaaaatggcccgagtgttctcggttctcagagaagagagcgagagtgtg
ctgacactgaaaggcttgacccccacgggtatgctccccagcggagtgctttctggaggg
aagcagacactgcaaagcgctatcaaaggattttcaccacaacataagatcactagcttc
gaggaggccaagggcttagaccgaattaacgagaggatgccacctcgcagagatgccatg
ccctctgacgccaaccttaactccatcaacaaggctctcgcctcagagactaacggcacg
gacagcaatggcagtaatagcagcaatatccagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100467683
Entry
100467683         CDS       T01329                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04720  Long-term potentiation
aml04724  Glutamatergic synapse
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100467683 (PPP3R1)
   04310 Wnt signaling pathway
    100467683 (PPP3R1)
   04370 VEGF signaling pathway
    100467683 (PPP3R1)
   04020 Calcium signaling pathway
    100467683 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    100467683 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100467683 (PPP3R1)
   04218 Cellular senescence
    100467683 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100467683 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    100467683 (PPP3R1)
   04660 T cell receptor signaling pathway
    100467683 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    100467683 (PPP3R1)
   04659 Th17 cell differentiation
    100467683 (PPP3R1)
   04662 B cell receptor signaling pathway
    100467683 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100467683 (PPP3R1)
   04921 Oxytocin signaling pathway
    100467683 (PPP3R1)
   04924 Renin secretion
    100467683 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100467683 (PPP3R1)
   04720 Long-term potentiation
    100467683 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    100467683 (PPP3R1)
   04380 Osteoclast differentiation
    100467683 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100467683 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100467683 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    100467683 (PPP3R1)
   05020 Prion disease
    100467683 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    100467683 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100467683 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100467683 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100467683 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    100467683 (PPP3R1)
   05163 Human cytomegalovirus infection
    100467683 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100467683 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100467683 (PPP3R1)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100467683 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 100467683
NCBI-ProteinID: XP_034515126
LinkDB
Position
4
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctaggaaagagatttaagaagctcgacttggacaattcgggatctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atatttgacacagatgggaatggagaagtagactttaaagaattcattgagggagtctct
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100474742
Entry
100474742         CDS       T01329                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04720  Long-term potentiation
aml04724  Glutamatergic synapse
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100474742 (PPP3R2)
   04310 Wnt signaling pathway
    100474742 (PPP3R2)
   04370 VEGF signaling pathway
    100474742 (PPP3R2)
   04020 Calcium signaling pathway
    100474742 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    100474742 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100474742 (PPP3R2)
   04218 Cellular senescence
    100474742 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100474742 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    100474742 (PPP3R2)
   04660 T cell receptor signaling pathway
    100474742 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    100474742 (PPP3R2)
   04659 Th17 cell differentiation
    100474742 (PPP3R2)
   04662 B cell receptor signaling pathway
    100474742 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100474742 (PPP3R2)
   04921 Oxytocin signaling pathway
    100474742 (PPP3R2)
   04924 Renin secretion
    100474742 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100474742 (PPP3R2)
   04720 Long-term potentiation
    100474742 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100474742 (PPP3R2)
   04380 Osteoclast differentiation
    100474742 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100474742 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100474742 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    100474742 (PPP3R2)
   05020 Prion disease
    100474742 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    100474742 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100474742 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100474742 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100474742 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    100474742 (PPP3R2)
   05163 Human cytomegalovirus infection
    100474742 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100474742 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100474742 (PPP3R2)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100474742 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 100474742
NCBI-ProteinID: XP_002926512
LinkDB
Position
7
AA seq 170 aa
MGNEASYPEEMCSHFNSDEIKRLGKRFKKLDLDSSGALSMEEFMSLPELQQNPLVQRVVD
VFDTDGNGEVDFKEFILGTSQFSVRGDEEQKLRFAFSIYDIDKDGYISNGELFQVLKLMV
GNNLKDWQLQQLVDKTIIILDRDGDGKISFEEFCAVVGGLEIHKKLVVVV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaagccagttacccggaggagatgtgctcccacttcaactctgatgaaatc
aaaaggctgggcaagaggtttaagaagctggacttggactcttcgggcgcgctgagcatg
gaggagttcatgtccctgcccgagctgcagcagaacccattggtgcagcgagtggtcgac
gtcttcgacaccgatggcaacggagaagtggacttcaaggagttcatcctggggacctcc
cagttcagtgtcaggggggacgaggagcaaaagttgaggtttgccttcagcatctacgac
attgataaagacggctacatttccaacggggagctcttccaggtgctgaagctgatggtg
ggcaacaacctgaaggactggcagctgcagcagctcgtggacaaaaccatcatcatcctg
gatcgggatggagacggcaaaatatccttcgaggaattctgtgctgtggttggaggcctg
gagatccacaagaagttggtggtggtagtgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100474970
Entry
100474970         CDS       T01329                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X5
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04720  Long-term potentiation
aml04724  Glutamatergic synapse
aml04728  Dopaminergic synapse
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100474970 (PPP3CB)
   04310 Wnt signaling pathway
    100474970 (PPP3CB)
   04370 VEGF signaling pathway
    100474970 (PPP3CB)
   04020 Calcium signaling pathway
    100474970 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    100474970 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100474970 (PPP3CB)
   04218 Cellular senescence
    100474970 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100474970 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    100474970 (PPP3CB)
   04660 T cell receptor signaling pathway
    100474970 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    100474970 (PPP3CB)
   04659 Th17 cell differentiation
    100474970 (PPP3CB)
   04662 B cell receptor signaling pathway
    100474970 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100474970 (PPP3CB)
   04921 Oxytocin signaling pathway
    100474970 (PPP3CB)
   04924 Renin secretion
    100474970 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100474970 (PPP3CB)
   04728 Dopaminergic synapse
    100474970 (PPP3CB)
   04720 Long-term potentiation
    100474970 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100474970 (PPP3CB)
   04380 Osteoclast differentiation
    100474970 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100474970 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100474970 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    100474970 (PPP3CB)
   05020 Prion disease
    100474970 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    100474970 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100474970 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100474970 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100474970 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    100474970 (PPP3CB)
   05163 Human cytomegalovirus infection
    100474970 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100474970 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100474970 (PPP3CB)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100474970 (PPP3CB)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100474970 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 100474970
NCBI-ProteinID: XP_011224729
Ensembl: ENSAMEG00000016865
LinkDB
Position
6
AA seq 480 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEI
IRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAE
KAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggatgggatacccagggttgatgttctgaagaaccacttagtaaaagaaggtcgggta
gatgaagaaattgcacttagaattatcaatgagggtgctgccatccttcggagagagaaa
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctg
aagattctgtacccaagcacattatttcttctgagaggcaatcatgaatgcagacacctt
actgaatattttacctttaagcaggaatgtaaaattaaatactcagaaagagtctatgaa
gcttgtatggaagcttttgatagtctgcctcttgctgcacttttaaatcaacaatttctt
tgtgttcatggtggactttcaccagaaatacacacactggatgatattaggagattagat
agattcaaagagccacctgcatttggaccaatgtgtgacttgctatggtccgatccttct
gaagattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacagtttaactgt
tctccacatccttactggttgcccaattttatggatgtcttcacatggtctttaccattt
gttggagaaaaagtgacagaaatgttggtaaatgttctgagtatttgctctgatgatgaa
ctgatgactgaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatc
ataagaaacaaaattcgagcaattggcaagatggcacgggtcttctctgttctcagggag
gagagtgaaagcgtgctgacactcaagggcctgactcccacagggatgttgcctagtgga
gtgttggctggaggacggcagaccctgcaaagtgccacagttgaggctattgaggctgaa
aaagcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggt
ttggataggatcaatgagagaatgccaccccggaaagatgctgtacagcaagatggtttc
aattctctgaacaccgcacatgccactgagaaccacgggactggcaaccatagtgcccag
tga

KEGG   Ailuropoda melanoleuca (giant panda): 100477289
Entry
100477289         CDS       T01329                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04114  Oocyte meiosis
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04720  Long-term potentiation
aml04724  Glutamatergic synapse
aml04728  Dopaminergic synapse
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04924  Renin secretion
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05152  Tuberculosis
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100477289 (PPP3CC)
   04310 Wnt signaling pathway
    100477289 (PPP3CC)
   04370 VEGF signaling pathway
    100477289 (PPP3CC)
   04020 Calcium signaling pathway
    100477289 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    100477289 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100477289 (PPP3CC)
   04218 Cellular senescence
    100477289 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100477289 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    100477289 (PPP3CC)
   04660 T cell receptor signaling pathway
    100477289 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    100477289 (PPP3CC)
   04659 Th17 cell differentiation
    100477289 (PPP3CC)
   04662 B cell receptor signaling pathway
    100477289 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100477289 (PPP3CC)
   04921 Oxytocin signaling pathway
    100477289 (PPP3CC)
   04924 Renin secretion
    100477289 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    100477289 (PPP3CC)
   04728 Dopaminergic synapse
    100477289 (PPP3CC)
   04720 Long-term potentiation
    100477289 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    100477289 (PPP3CC)
   04380 Osteoclast differentiation
    100477289 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100477289 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100477289 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    100477289 (PPP3CC)
   05020 Prion disease
    100477289 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    100477289 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    100477289 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100477289 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100477289 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    100477289 (PPP3CC)
   05163 Human cytomegalovirus infection
    100477289 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100477289 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100477289 (PPP3CC)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100477289 (PPP3CC)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100477289 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 100477289
NCBI-ProteinID: XP_034517170
Ensembl: ENSAMEG00000003134
LinkDB
Position
5
AA seq 532 aa
MAAASPALSVPDLGAGAVPFPPTQRLTLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLFLWSLKINHPKTVFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIKKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDEIEDHYISSYRKGGTTVRKEIIKNKIRAIGKMARVFSILREES
ESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLD
RINERMPPRKDSQYPDGPVKLVAPPQPNAAHRSDRGRRASNDAEPCCGTGCH
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggccgctgcttcgccggcgctttccgtgccggacctaggagctggtgctgttcccttt
cctccaacccaacggcttactttgaaggaagtgtttgagaatgggaaacctaaaattgat
gttttgaaaaaccatttggtgaaagaagggcgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgagacaagagaagaccatgatagaagtagatgctcca
atcacggtgtgtggtgacattcatggacagttctttgacctgatgaagttgtttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtttttatggagtttaaagattaatcatcccaaaacagtg
tttctgcttcgaggaaatcatgaatgcaggcatcttacagaatacttcaccttcaaacag
gaatgtcgaatcaaatattctgaacaggtgtatgatgcgtgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctgtgtgtacatggagggatgtcacct
gaaattactagtttagatgacattaagaaattagatcggtttaaagaacctccagccttt
gggccagtgtgtgacctgctttggtctgatccttcagaggattatggcaatgaaaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttttacagttaccctgca
gtctgtgaatttttgcagaacaataatttgttatcaataatcagagctcatgaagcccag
gatgctgggtatcgaatgtacaggaagagccaaacaacaggctttccatcactcattaca
attttctctgcccccaattacctagatgtctataataataaagctgctgtgctaaaatac
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggacgttttcacatggtctttgccatttgttggggaaaaagtcacagagatg
ctggttaacattctcaacatatgctctgatgatgaattgatttccgatgatgaaattgaa
gatcactacatttcaagctatcggaaaggaggcactacagttcgaaaggaaatcatcaag
aataaaatcagagccattgggaagatggcacgggtcttttcaattctgcgggaagagagt
gagagtgtgctgactctcaagggcctgactccaacagggacactccctctaggtgtcctc
tcaggaggaaaacagactattgagacagccacagtagaagcggtagaggcccgggaagcc
atcagagggttttcgcttcagcacaggatccggagttttgaagaagcccgaggtctggac
cgaattaacgaacggatgccaccccgaaaagacagccagtaccccgatgggccagtgaaa
ttggttgcccctccacaacccaacgctgcgcacaggagcgacagggggagaagagccagt
aatgacgcagagccctgctgtggcacagggtgccattga

DBGET integrated database retrieval system