KEGG   Ailuropoda melanoleuca (giant panda): 100467724
Entry
100467724         CDS       T01329                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X3
  KO
K08774  transforming growth factor, alpha
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04915  Estrogen signaling pathway
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100467724 (TGFA)
   04012 ErbB signaling pathway
    100467724 (TGFA)
   04014 Ras signaling pathway
    100467724 (TGFA)
   04151 PI3K-Akt signaling pathway
    100467724 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100467724 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467724 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100467724 (TGFA)
   05212 Pancreatic cancer
    100467724 (TGFA)
   05225 Hepatocellular carcinoma
    100467724 (TGFA)
   05214 Glioma
    100467724 (TGFA)
   05211 Renal cell carcinoma
    100467724 (TGFA)
   05215 Prostate cancer
    100467724 (TGFA)
   05223 Non-small cell lung cancer
    100467724 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100467724 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 100467724
NCBI-ProteinID: XP_011217604
Ensembl: ENSAMEG00000015985
LinkDB
Position
4
AA seq 160 aa
MVPSAGQLALFALGLLLAVCQALENSTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIACVL
IHCCQVRKHCEWCQALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccttgttcgcgctgggtctcttgttggctgtgtgc
caggccttggagaacagcacgtccgctctgagtgcagacccgcctgtggccgcagctgtg
gtgtcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaagacaagccagcgtgcgtctgtcattctgggtatgtgggcgcg
cgctgtgagcatgccgacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggccgtcctcatcatcgcgtgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccaggctctcatctgccggcac
gagaagcccagtgccctgctgaagggaaggaccgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system