KEGG   Ailuropoda melanoleuca (giant panda): 100467733
Entry
100467733         CDS       T01329                                 

Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04072  Phospholipase D signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04510  Focal adhesion
aml04540  Gap junction
aml04630  JAK-STAT signaling pathway
aml04810  Regulation of actin cytoskeleton
aml05160  Hepatitis C
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05226  Gastric cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100467733
   04012 ErbB signaling pathway
    100467733
   04014 Ras signaling pathway
    100467733
   04015 Rap1 signaling pathway
    100467733
   04630 JAK-STAT signaling pathway
    100467733
   04066 HIF-1 signaling pathway
    100467733
   04068 FoxO signaling pathway
    100467733
   04020 Calcium signaling pathway
    100467733
   04072 Phospholipase D signaling pathway
    100467733
   04151 PI3K-Akt signaling pathway
    100467733
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100467733
   04540 Gap junction
    100467733
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100467733
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467733
   05231 Choline metabolism in cancer
    100467733
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100467733
  09162 Cancer: specific types
   05210 Colorectal cancer
    100467733
   05212 Pancreatic cancer
    100467733
   05226 Gastric cancer
    100467733
   05214 Glioma
    100467733
   05218 Melanoma
    100467733
   05219 Bladder cancer
    100467733
   05215 Prostate cancer
    100467733
   05213 Endometrial cancer
    100467733
   05224 Breast cancer
    100467733
   05223 Non-small cell lung cancer
    100467733
  09172 Infectious disease: viral
   05160 Hepatitis C
    100467733
   05165 Human papillomavirus infection
    100467733
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100467733
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100467733
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100467733
SSDB
Motif
Pfam: Ldl_recept_b EGF_CA EGF_3 EGF FXa_inhibition cEGF DUF5050 hEGF Tr-sialidase_C EGF_MSP1_1
Other DBs
NCBI-GeneID: 100467733
NCBI-ProteinID: XP_034527269
LinkDB
Position
11
AA seq 998 aa
MLLFLITLLPVVFQCRFAGLSVVQRWNCPAGSCSGKGNSTCVGPAPFLIFSHGNSIFRID
LEGTNHEQLVADAGVSVIMDFHYNEGRIYWVDLERKLLQRVFLNGTRQESICNIEKNVSG
MAVNWINEELIWSNQQEGIITVTDMKGNNSRVLLSALNYPANVAIDPVERFIFWSSEVAG
GLHRADLNGVEEKILLKTSERITAVSLDVLDKRLFWIQYNRDESNSYICSCNYDGGSVHF
SKHLTQHSLFAMSLFGDRIFYSAWKKKTIWIANKHTGKDMVKINLDPSFVPPGGIKVVHP
LLQPKAESDTWAPDQNLCKWRKGNCRGGKCGQDSKSHLCTCAEGYTLSQDGKYCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFILLPDGKQCHQLISCPSNTSKCSHDCVLTSDGPV
CFCPEGSALETDGKACSGCSSPDNGGCSQLCLPLSPVSWECGCFPGYDLQLDKKSCVASG
PQPFLLFANSQDIRRMHFDGTDYGTLLSQQMGMVFALDHDPVENKIYFAQTALKWIERAN
TDGSQRERLVEEAVDVPEGLAVDWIDRKLYWTDRGKSLIEGSDLSGKHREIIIKEDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGIGRLVIASSDLVWPSGITIDYLTDKLYWCD
AKLSVIEMANLDGSKRQRLAQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGAQPCLHQNGGCEHICKERFGTAQCLCREGFVKAPDGKMC
LALNGHEIPAGNEADQVTPLDVLSRNRGFEDSVTESQRLLVAEIMVSDADDCGPVGCSTR
AQCVSEGENATCQCLKGFTGNGKLCFDIDECETGTTVCPPTSSKCVNTEGGYVCRCSEGY
RGDGIHCLDINECQLGMHTCGENATCTNTEGNYTCMCAGSLSEPGQICADSTPSSHLMED
GRHSVRTSDHECPSSYEGYCLYNGVCMYIEAVDRYACK
NT seq 2997 nt   +upstreamnt  +downstreamnt
atgctcctcttcctcatcactctgttgccggtagtttttcagtgtcgttttgctggtctc
tcagttgtgcaacgctggaactgtcctgcaggctcttgttcaggaaaggggaattctact
tgtgtgggtcctgcacccttcttgattttctcccatggaaacagtatctttaggattgat
ctcgaaggaactaatcatgagcaattggtggcagatgctggtgtatcagtgatcatggat
tttcattacaatgagggaagaatctattgggtagatctagagagaaaacttttgcaaaga
gtttttctgaatgggacaaggcaagagagcatatgcaatatagagaaaaatgtttcagga
atggcagtaaattggataaacgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaacaattcccgagttctcttaagcgccttaaattatcct
gcaaatgtagcaattgatccagtagaaaggtttatattttggtcttcagaggtggctggt
ggccttcacagagccgatctcaacggtgtggaagagaagattctgttaaagacgtcagaa
agaataacagccgtgtcattggatgtgcttgataaacggcttttttggattcagtataac
agagatgaaagcaattcttatatttgttcctgtaattatgatggaggttctgtccatttt
agcaaacatctcacacagcacagtttgtttgcaatgtccctttttggtgatcggatcttc
tattcagcatggaagaagaagacaatttggatagctaacaaacacactgggaaggatatg
gttaaaattaacctcgacccatcgtttgtaccacccggtggaatcaaagtagtgcatcca
ctcttacagcccaaggcagagagtgatacttgggcacctgatcagaacctctgcaaatgg
aggaaaggtaactgcagaggcggcaagtgtggtcaagactcgaagtcccatctgtgcaca
tgtgcggagggatatactttaagccaagacggaaagtactgtgaagatgtcaatgaatgt
gccttttggaatcatggctgtactcttgggtgcgaaaacatccctggatcttattattgc
acatgtcctgtaggatttattctgcttcctgatgggaaacagtgtcatcaattaatttcc
tgtccaagcaatacatctaaatgtagccatgactgtgttctgacatcagatggtcccgta
tgtttctgtcctgaaggctcagcacttgagacagatggaaaagcatgtagtggctgttcc
tcacctgataatggtggatgcagccagctctgcctccctctcagccctgtctcctgggag
tgtggttgctttcctggatatgacctccaactggacaagaaaagctgtgtggcgtcagga
ccacaaccatttttgctgtttgccaattctcaagatattagacgcatgcattttgatgga
acagattatggaaccctgctcagccagcaaatgggaatggtttttgcccttgatcatgac
cctgtggaaaataagatatactttgcccagacagccctgaagtggatagagcgagctaat
acggatggttcccagcgagaaaggcttgttgaggaagcagtagatgtgccggaaggtctt
gccgttgattggattgaccgtaaattgtactggacagacagagggaaatctctcattgaa
gggagtgatttaagtggaaaacatcgtgaaataatcatcaaggaggacatctctcagcca
cgaggaattgctgtccatccgatggccaagagattattctggactgatatggggattaat
ccacgaattgaaagttcttctcttcaaggcattggccgactggttatagctagttctgat
ctggtttggcccagtggaataacaattgattacttaactgacaaattgtattggtgtgat
gccaagctgtctgtcatcgaaatggccaatctggatggttcaaaacgccaaagacttgcc
cagaacgatgtagggcacccctttgctgtggctgtgtttgaggatcatgtgtggttctcg
gattggactatgccatcggtaataagggtgaacaagaggactggcaaaaatagggtacgt
ctccgaggcagcatgctgaagccttcatcactggttgtagttcatccattggcaaaacca
ggagcacagccctgcttacatcaaaatggaggctgtgaacatatttgcaaagagaggttt
ggaactgctcagtgtttgtgtcgcgaaggttttgtgaaagccccagatgggaaaatgtgt
ctggctctgaatggccatgagataccggcaggtaatgaagcagatcaagtaacaccattg
gatgtcttatccaggaacagaggatttgaagatagcgttacagaatctcagcgtttgcta
gtggctgaaatcatggtatcagatgctgatgactgcggtcctgtgggatgcagtacacga
gctcagtgtgtttcagagggagaaaatgccacatgtcagtgtttgaaaggatttactggg
aatggaaaactgtgttttgatatagatgaatgtgagacgggcaccacagtttgccctcct
acctcctctaagtgcgtcaatactgaaggcggctatgtctgccggtgctcagaaggctac
cgaggcgatgggattcactgtcttgatattaatgagtgccaattgggcatgcacacctgt
ggggaaaatgccacctgtacaaatacggaggggaactacacctgcatgtgtgccggcagc
ctgtctgaacctggacagatatgcgctgactccactccatcttctcatctcatggaggat
ggccgccattctgtgagaactagtgaccacgaatgcccctcatcctatgagggctactgc
ctctataacggtgtgtgtatgtacatcgaagcagttgacagatacgcatgcaagtaa

DBGET integrated database retrieval system