KEGG   Ailuropoda melanoleuca (giant panda): 100467824
Entry
100467824         CDS       T01329                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04012  ErbB signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04151  PI3K-Akt signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04934  Cushing syndrome
aml05162  Measles
aml05165  Human papillomavirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05215  Prostate cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100467824 (CDKN1B)
   04066 HIF-1 signaling pathway
    100467824 (CDKN1B)
   04068 FoxO signaling pathway
    100467824 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100467824 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100467824 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100467824 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100467824 (CDKN1B)
   05206 MicroRNAs in cancer
    100467824 (CDKN1B)
   05203 Viral carcinogenesis
    100467824 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100467824 (CDKN1B)
   05220 Chronic myeloid leukemia
    100467824 (CDKN1B)
   05215 Prostate cancer
    100467824 (CDKN1B)
   05222 Small cell lung cancer
    100467824 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100467824 (CDKN1B)
   04934 Cushing syndrome
    100467824 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100467824 (CDKN1B)
   05169 Epstein-Barr virus infection
    100467824 (CDKN1B)
   05165 Human papillomavirus infection
    100467824 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100467824 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100467824
NCBI-ProteinID: XP_002918025
Ensembl: ENSAMEG00000010769
UniProt: G1LW64
LinkDB
Position
16
AA seq 200 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGVCKVPAQESQDVSGNRQAVPLIG
SQANSEDTHLVDQKTDTPDNQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPN
ANAGSVEQTPKKPGLRRRQT
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctagagcggatggatgccagacag
gcggagtaccccaagccctccgcctgcagaaacctcttcggcccggtcaaccacgaagag
ttgacccgggacttggagaagcactgcagagacatggaagaggcaagccagcgcaagtgg
aattttgacttccagaatcacaagcccctggagggcaaatacgagtggcaggaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgtctgcaag
gtgccggcgcaggagagccaggacgtcagcgggaaccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacacatttggtagaccaaaagactgatacgccggacaac
cagaccgggttagcggagcagtgcactgggataaggaagcgacctgccacagacgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtctcagacggttccccgaac
gcgaacgcgggttcagtggagcagacgcccaagaagccgggcctccgaagacgtcaaacg
taa

DBGET integrated database retrieval system