KEGG   Ailuropoda melanoleuca (giant panda): 100468080
Entry
100468080         CDS       T01329                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04510  Focal adhesion
aml04650  Natural killer cell mediated cytotoxicity
aml04722  Neurotrophin signaling pathway
aml04910  Insulin signaling pathway
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05034  Alcoholism
aml05100  Bacterial invasion of epithelial cells
aml05214  Glioma
aml05220  Chronic myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100468080 (SHC3)
   04014 Ras signaling pathway
    100468080 (SHC3)
   04072 Phospholipase D signaling pathway
    100468080 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100468080 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100468080 (SHC3)
   04062 Chemokine signaling pathway
    100468080 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100468080 (SHC3)
   04915 Estrogen signaling pathway
    100468080 (SHC3)
   04917 Prolactin signaling pathway
    100468080 (SHC3)
   04926 Relaxin signaling pathway
    100468080 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    100468080 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100468080 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100468080 (SHC3)
   05226 Gastric cancer
    100468080 (SHC3)
   05214 Glioma
    100468080 (SHC3)
   05220 Chronic myeloid leukemia
    100468080 (SHC3)
   05224 Breast cancer
    100468080 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    100468080 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100468080 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100468080 (SHC3)
   01522 Endocrine resistance
    100468080 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 100468080
NCBI-ProteinID: XP_034502830
Ensembl: ENSAMEG00000003321
LinkDB
Position
17
AA seq 469 aa
MRAARKGRPGDQPLPRAPHASDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREA
ISRVCEAVPGAKGAFRKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQI
IANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFELR
FKQYLQCPSKVPAFHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKTPPPGGFVDVRLHTRP
HAPDTAQFAGKEQTYYQGRHLGDPFGEDWQQTPVRQGSSDIYSMPEGRVHVAPGEAPTYV
NAQPLPPQATPASGSSTESSPRKDLFDMKPFEDALRNQSLGPVLSKAASVECVSPVTPRA
PDAKMLEELEREPWYQGEMSRKEAEGLLKKDGDFLVRRSATNPGSFVLTGMHNGQAKHLL
LVDPEGTIRTKDRVFDSISHLINHHLENSVPIVSAGSELCLQQPVEKTL
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgcgcgccgccaggaagggtcggcccggcgaccagccgctgccgcgcgccccgcacgcc
agcgaccaggtgctgggggccggagtcacctacgtcgtcaagtacttggggtgcattgaa
gttctccgctcaatgaggtctcttgacttcagtacaagaacacagattaccagggaagcc
atcagccgtgtgtgtgaagccgtccctggtgccaagggagccttcaggaagagaaagcct
cccagcaaaatgctgtccagcatcttgggcaagagcaacctccagtttgcggggatgagc
atctccctgaccatatccaccgccagcctgaacctgcgcacgcccgactcgaaacagatc
atcgcgaaccaccacatgcagtccatctccttcgcatcggggggagacccggacacaaca
gactacgttgcgtacgtagcgaaggaccccgttaatcgcagagcttgtcacattctggag
tgctgtgacggcctggcccaggatgtcatcggctctatcggacaggcctttgaactccgg
tttaagcaatatttgcagtgtccttccaaggtgcccgcgttccacgaccgaatgcagagt
ctggatgagccttggactgaagaggagggggatggttcagaccacccatactacaacagc
atcccaagcaagacgcctcctccagggggcttcgtggatgtgcggctgcacaccagaccc
catgcccctgacacagcgcagtttgcaggaaaagagcaaacttactaccaggggagacac
ttaggagacccatttggcgaagactggcagcaaacacctgtcaggcaagggtcctcggac
atctacagcatgccggaggggagagtgcacgtggcccctggagaagcccccacctacgtg
aacgcccaacccctcccaccgcaggccacgccagcctcgggcagcagcacagagagcagc
cctcggaaggacctctttgacatgaaaccttttgaagatgctctcaggaaccagtccttg
gggcctgtgctgagcaaagcagcctccgtggagtgcgtcagccccgtcacccccagagcc
ccagatgccaagatgctggaggagctagaacgggagccttggtaccaaggggagatgagc
cggaaggaggccgaggggctgctaaagaaggatggggacttcctggtcaggaggagcgcc
acaaacccaggctccttcgtcctcacgggaatgcacaacggccaggccaagcacctgctg
ctggtggacccggaaggcacgatccggacgaaagacagggtctttgacagcatcagccac
ctcatcaaccaccacctggagaacagcgtgcccatcgtctccgccggaagcgagctctgc
ctgcagcagccggtggagaagaccctgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100475137
Entry
100475137         CDS       T01329                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4 isoform X2
  KO
K17449  SHC-transforming protein 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04510  Focal adhesion
aml04650  Natural killer cell mediated cytotoxicity
aml04722  Neurotrophin signaling pathway
aml04910  Insulin signaling pathway
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05034  Alcoholism
aml05100  Bacterial invasion of epithelial cells
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05220  Chronic myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100475137 (SHC4)
   04014 Ras signaling pathway
    100475137 (SHC4)
   04072 Phospholipase D signaling pathway
    100475137 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100475137 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100475137 (SHC4)
   04062 Chemokine signaling pathway
    100475137 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100475137 (SHC4)
   04915 Estrogen signaling pathway
    100475137 (SHC4)
   04917 Prolactin signaling pathway
    100475137 (SHC4)
   04926 Relaxin signaling pathway
    100475137 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    100475137 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100475137 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100475137 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100475137 (SHC4)
   05226 Gastric cancer
    100475137 (SHC4)
   05214 Glioma
    100475137 (SHC4)
   05220 Chronic myeloid leukemia
    100475137 (SHC4)
   05224 Breast cancer
    100475137 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    100475137 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100475137 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100475137 (SHC4)
   01522 Endocrine resistance
    100475137 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100475137
NCBI-ProteinID: XP_002917591
Ensembl: ENSAMEG00000001535
UniProt: G1L406
LinkDB
Position
5
AA seq 630 aa
MRKRGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDESSPGGSVGNKGSPQPPY
PTLAPHLPAEDATLASQESPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPTSPETGLNRAGTGPPPQPDLVGHRATVLTPDACPLPGPGEPTPGSRQDRH
FLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVSGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNIDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEM
PVDGPTEEREDHEYYNEIPGKQPPTGGVSDVRIKVQATEQMAYCPIRCEKLCYLPGNSKF
SSVYENCLEQNQAIGNAPERGVQSHRDASLMKHGCRVDFFNDPCYINTQALQSTLGSAPD
QSSAHPLGSPWHREKAPETVQPGATAQAASSHSLPHIKQQLRNEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPGLLHCNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgaaaacgcggtcaggacagcctggcaggacttgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgttttcggaatgagtccatcacgtcc
ttggacgaaagcagccccggaggctcggtggggaacaagggctcgcctcagcctccctac
cccaccctggcacctcacctgccggccgaagatgccaccttggcgtcccaggagagcccc
accccactgtgcaccttgatccctcgcatggccagcgtgaagctggccaacccagccacc
ctgctgagtctgaaaaacttttgcttgggtaccaaagaggtgccccggctgaagctccag
gaaagccaggacccggctcccagcagcccaacttcccctgagaccggtctaaatagggct
gggaccggacctccgccgcagccagacctggtggggcacagggcgactgtcttaactcca
gatgcctgtccccttcctggccctggggagccgaccccagggagcaggcaggacaggcac
tttctgcagcacctgttggggatgggcatgaactactatgtgaggtacatgggctgtatt
gaagtactgcagtcaatgaggtcactggattttggaatgagaacccaagttacaagggaa
gcaataagccgcctgtgtgaagctgtttctggggcaaatggagccattaaaaagcgaaag
cctccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttcgggaatg
aatattaaactgaccatctcaacatgcagcctcacattgatgaatattgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgtcacatactg
gaatgccgcagcggaatggcccaagatgtcataagcaccatagggcaggcttttgaactc
cggtttaaacagtatttgaaaaatccttctttgaatacttcttgtgaaagtgaggagatg
cccgttgatggtcccactgaggaaagagaagaccacgagtactacaacgaaatccccggg
aagcagccaccgacaggtggtgtttctgatgtgcggatcaaagtccaagccacagagcaa
atggcttactgccccatacggtgtgagaagttgtgctatttgcctgggaactccaagttc
agcagcgtgtatgagaactgtttagaacaaaaccaggcaataggtaatgcaccggagaga
ggagtgcagtcccatcgagatgcctcgttaatgaagcacggctgtcgagtggatttcttc
aatgacccctgctacataaatacgcaggctcttcagagtacacttggctctgccccggat
caaagctcagctcaccccctggggagcccatggcaccgtgaaaaagcaccagaaactgtt
cagccaggtgccacggcccaggctgccagctcacattctttgccacacattaagcagcag
ctgcggaatgaagactgctaccacggcaaactgagcaggaaggcagcagagagcctcttg
gtaaaggatggggactttttggttcgagagagtgcaacatctcctggccagtatgtgcta
agtggcctacagggaggccaggcaaagcatcttctcctggtggatcctgaaggcaaggtc
aggaccaaggatcatgtatttgataatgtcggtcaccttatcagataccacatggataac
agtttgccaatcatctcttccggaagcgaagtaagcctcaaacaacccgtgagaaaagat
aataatccaggacttttgcattgcaacaaatga

KEGG   Ailuropoda melanoleuca (giant panda): 100480694
Entry
100480694         CDS       T01329                                 

Gene name
SHC2
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04370  VEGF signaling pathway
aml04510  Focal adhesion
aml04650  Natural killer cell mediated cytotoxicity
aml04722  Neurotrophin signaling pathway
aml04910  Insulin signaling pathway
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05034  Alcoholism
aml05100  Bacterial invasion of epithelial cells
aml05214  Glioma
aml05220  Chronic myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100480694 (SHC2)
   04014 Ras signaling pathway
    100480694 (SHC2)
   04370 VEGF signaling pathway
    100480694 (SHC2)
   04072 Phospholipase D signaling pathway
    100480694 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100480694 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100480694 (SHC2)
   04062 Chemokine signaling pathway
    100480694 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100480694 (SHC2)
   04915 Estrogen signaling pathway
    100480694 (SHC2)
   04917 Prolactin signaling pathway
    100480694 (SHC2)
   04926 Relaxin signaling pathway
    100480694 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    100480694 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100480694 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100480694 (SHC2)
   05226 Gastric cancer
    100480694 (SHC2)
   05214 Glioma
    100480694 (SHC2)
   05220 Chronic myeloid leukemia
    100480694 (SHC2)
   05224 Breast cancer
    100480694 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    100480694 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100480694 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100480694 (SHC2)
   01522 Endocrine resistance
    100480694 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 100480694
NCBI-ProteinID: XP_034513219
Ensembl: ENSAMEG00000002628
LinkDB
Position
4
AA seq 571 aa
MTQGPGGRTPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPAGFLGRGPAXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXARAAGARGPRGARGVAGPPDAAADEWIRKGSFIHKPA
HGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGS
WKRKAPNKALASVLGKSNLRFAGMSIAVSISTDGLNLSVPATRQIIANHHMQSISFASGG
DTDMTDYVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPRVVVPP
ERLTRPEESAWGDEEEMEHNYYNSIPGKEPPLGGLVDSRLTLTQPCALGTLGALGQGASP
AQRDTRSLPWDLGPSGTGPPGDGYVQADAKGPRDYEDHLYVNTQGLDTPEALQLEDSPKK
DLFDMRPFEDALKLHECSVGAETAVAPLPLEDQWPSPPTRRAPIAPTEEQLRQEPWYHGQ
MSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFESI
SHLIDYHLQNGQPIVAAESELHLRGVVKREP
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcacgccccccgcaccccctgcgcccccggagcccgag
gcgcccaccaccttctgcgcgctgctgccgcgcatgccgcagtggaagttcgctgccccc
gcgggcttcctgggccggggcccggcgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnccgcccgggctgccggggcccggggaccgcggggcgcgcggggggtggccggg
cccccggacgccgccgccgacgagtggatccgcaaaggcagcttcatccacaagccggcg
cacggctggctacacccagatgccagggtcctggggcccggggtctcctacatcgtgcgg
tacatgggctgcatcgaagtcctccgctccatgcgctctctggattttaacacccgcacc
caggtgaccagggaagccatcaaccggctccatgaggcggtgcccggcgtccggggctcc
tggaagaggaaggcccccaacaaagcgctggcctccgtcctgggcaagagcaacttgcgg
ttcgccggcatgagtattgctgtgagcatctccacggacggcctcaacctctccgtgccc
gccacacgccagatcattgccaaccaccacatgcagtccatctccttcgcgtcgggtggt
gacacggacatgacggattacgtggcctatgtagccaaggatcccatcaaccagagagcc
tgccacatcctggagtgctgtgagggcctcgcccagagcgtcatcagcaccgtgggccaa
gccttcgagctgcgcttcaagcagtacctgcacagcccccccagggtggtcgtgccgccg
gagaggctgaccaggccagaggagtcggcctggggggacgaggaggaaatggaacacaat
tactacaacagcatcccggggaaggagccgcccctgggtgggctggtggactccaggctc
accctaactcagccctgtgccctcgggaccctcggagccctcggccagggggcatctcct
gctcaaagggacacgcgcagcctgccatgggacctgggcccgtcaggtactggcccacca
ggggatggctacgtgcaggccgacgccaagggtcccagagactacgaggaccacctgtat
gtcaacacacagggtctggacaccccagaggccctgcagctggaggacagccccaagaag
gatctgtttgacatgcgacccttcgaggacgctctcaagctgcacgaatgctctgtgggg
gcggaaacggcggtagcgccccttcccttggaggaccagtggcctagtcccccaacccgc
cgggcccccatcgcccccacggaggagcagctgcggcaggagccctggtaccatggccag
atgagccgaagggcggcggagaagctgcttcgagccgacggggactttctggtgcgcgac
agcgtaaccaaccccgggcagtacgttctcacgggcatgcacgccgggcagcccaagcac
ctgctgctcgtggaccccgagggcgtggtgcggaccaaggacgtgctctttgagagtatc
agccatctgatcgactaccacctgcagaacgggcagcccatcgtggccgccgaaagcgag
ctgcatctgcgcggtgtggtcaaacgtgagccctga

KEGG   Ailuropoda melanoleuca (giant panda): 100480856
Entry
100480856         CDS       T01329                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X2
  KO
K06279  SHC-transforming protein 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04062  Chemokine signaling pathway
aml04072  Phospholipase D signaling pathway
aml04510  Focal adhesion
aml04650  Natural killer cell mediated cytotoxicity
aml04722  Neurotrophin signaling pathway
aml04910  Insulin signaling pathway
aml04915  Estrogen signaling pathway
aml04917  Prolactin signaling pathway
aml04926  Relaxin signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05034  Alcoholism
aml05100  Bacterial invasion of epithelial cells
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05220  Chronic myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100480856 (SHC1)
   04014 Ras signaling pathway
    100480856 (SHC1)
   04072 Phospholipase D signaling pathway
    100480856 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100480856 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100480856 (SHC1)
   04062 Chemokine signaling pathway
    100480856 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100480856 (SHC1)
   04915 Estrogen signaling pathway
    100480856 (SHC1)
   04917 Prolactin signaling pathway
    100480856 (SHC1)
   04926 Relaxin signaling pathway
    100480856 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    100480856 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100480856 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100480856 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100480856 (SHC1)
   05226 Gastric cancer
    100480856 (SHC1)
   05214 Glioma
    100480856 (SHC1)
   05220 Chronic myeloid leukemia
    100480856 (SHC1)
   05224 Breast cancer
    100480856 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    100480856 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100480856 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100480856 (SHC1)
   01522 Endocrine resistance
    100480856 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100480856
NCBI-ProteinID: XP_002922529
Ensembl: ENSAMEG00000011498
LinkDB
Position
8
AA seq 583 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRPGPKGEPGRAAEDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAPLGAARSTPPGVQSPSHLGATLPVGQPVGGDPEIRKQKPPPPPCPGKE
FFDDPSYVNVQNLDKARQAGGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPTTQAVAMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHVDNHLPIISAGSELCLQQPVERKL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaacccacttcggaatgagtctctgtcatcg
ctggaggagggggcttcagggtccaccccaccggaggagctgccttccccatcagcctcg
tccctggggcccatcctgccacctctgcctggggatgatagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaaactggccaacccagccggggggcgcccggggcca
aagggggagccaggaagggcagcggaggatggggaggggatcgtaggggcggccatgcca
gactcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacctggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgtgccttggac
ttcaacacccgcacccaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccc
ggtgccaagggggcaacaaggaggagaaagccctgtagccgcccgctcagttccatcctg
gggaggagtaacctgaaatttgccgggatgcccatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcagtctatc
tcgtttgcgtccggtggagacccggacacagccgagtacgtcgcctatgttgccaaagac
ccggtgaatcagagagcctgtcacatcctggagtgtcccgaagggctcgctcaggatgtc
atcagcaccatcggccaggccttcgagttgcgcttcaaacaatacctcaggaacccgccc
aagctggtcacccctcacgacaggatggccggttttgacggctcagcttgggatgaggag
gaggaagagccacctgaccaccagtactataatgatttcccggggaaggaacctcctctt
gggggagtggtggacatgaggcttcgggaaggagcccccctgggggctgctcggtccact
ccacctggtgtccagtcccccagccacctgggagcaacgctgcctgtggggcagcctgtc
gggggagacccagaaattcgcaaacagaagccacctccaccaccctgcccaggtaaagag
ttctttgatgatccttcctatgtcaacgtccagaacctagacaaggcccggcaagcagga
ggtggggctgggccccccaatcctgccatcaatggcagtgcgcccagagacctctttgac
atgaagccctttgaagatgcccttcgggtgcctccaactacccaggccgtggccatggct
gagcagctccgaggggagccctggttccacgggaagctgagccggcgggaggctgaagca
ctgctgcagctcaacggggacttcctggtgcgggagagcacgaccaccccgggccagtac
gtgctcaccggcttgcagagtgggcagcccaagcacctgctgctggtggaccctgagggc
gtggttcggacaaaggatcaccgctttgagagtgtcagccacctcatcagctaccatgtg
gacaatcacttgcccatcatctctgcaggcagtgaactatgtctacagcagcccgttgag
cggaagctgtga

DBGET integrated database retrieval system