KEGG   Ailuropoda melanoleuca (giant panda): 100468303Help
Entry
100468303         CDS       T01329                                 

Gene name
CA5A
Definition
(RefSeq) carbonic anhydrase 5A
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00910  Nitrogen metabolism
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    100468303 (CA5A)
Enzymes [BR:aml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     100468303 (CA5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 100468303
NCBI-ProteinID: XP_011227875
LinkDB All DBs
Position
Un
AA seq 307 aa AA seqDB search
MLRPPLLGRSLRKSSGFSILVKQMWGALRSSPQRLERWYSQGPCAQRNRNDALHPPCKGP
ASAPGGTRQSPINIRWRDSVYDPQLKPLRVCYAASCLHVWNTGYFFQVEFDDSAEGSGIS
GGPLENHYRLKQCHFHWGAVNERGSEHTVDDRVYPAELHLVHWNSVKYRSYKEALTGENG
MAVIGVFLKLGAHHEALQKLVEVLPEIKHKGARSAVGPFQPARLLPACRDYWTYAGSLTT
PPLSESVTWVIQKQPIEIAQSQLAAFRSLLFSALGEEERSMVDNYRPLQPLMNRKVRSSF
RAVEEGI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctacggcccccgttgttgggcaggagcctccggaagtcctctggtttctccatcttg
gtcaagcagatgtggggggccctccgcagtagtccacaaaggctggagcgatggtactcg
cagggtccctgcgcacagagaaatcggaacgacgctttgcaccccccctgcaagggcccg
gcttcggctccggggggcacccggcagtcccccatcaacatccgctggagggacagcgtc
tacgacccgcagctgaagcctctcagggtctgctacgcggccagctgcctgcacgtctgg
aacaccggctacttcttccaggtggaattcgacgactcggctgaggggtcagggatcagc
ggtggccccttggaaaaccactacagactaaagcagtgccacttccactggggagcagtg
aacgagcggggctccgagcacacagtggacgaccgcgtgtacccggcagagctgcattta
gttcactggaattcggtgaaataccgaagttacaaagaagccctcacgggggagaacggc
atggccgtgataggcgtgtttttaaagctgggggcccatcacgaggcactgcagaagctg
gtggaagtcttgccggaaataaagcataagggtgcgcgctccgccgtgggccccttccag
cccgcccgtctcctgcccgcctgccgggactactggacctacgcaggctccctcaccacg
cctccgctcagcgagtcggtcacctgggtcatccagaagcagcccattgaaatagctcag
agccagctggctgcctttcgctcactcctgttttctgcacttggtgaagaagagcgttcg
atggtggacaactaccgtcctcttcaacccctgatgaaccggaaggtccgttcatccttc
cgggctgtggaggaaggcatctga

DBGET integrated database retrieval system