KEGG   Ailuropoda melanoleuca (giant panda): 100468314
Entry
100468314         CDS       T01329                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04115  p53 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04218  Cellular senescence
aml04914  Progesterone-mediated oocyte maturation
aml04934  Cushing syndrome
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05215  Prostate cancer
aml05222  Small cell lung cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100468314 (CDK2)
   04151 PI3K-Akt signaling pathway
    100468314 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100468314 (CDK2)
   04114 Oocyte meiosis
    100468314 (CDK2)
   04115 p53 signaling pathway
    100468314 (CDK2)
   04218 Cellular senescence
    100468314 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100468314 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468314 (CDK2)
   05203 Viral carcinogenesis
    100468314 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100468314 (CDK2)
   05215 Prostate cancer
    100468314 (CDK2)
   05222 Small cell lung cancer
    100468314 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100468314 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100468314 (CDK2)
   05161 Hepatitis B
    100468314 (CDK2)
   05160 Hepatitis C
    100468314 (CDK2)
   05162 Measles
    100468314 (CDK2)
   05169 Epstein-Barr virus infection
    100468314 (CDK2)
   05165 Human papillomavirus infection
    100468314 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100468314 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100468314 (CDK2)
   03036 Chromosome and associated proteins [BR:aml03036]
    100468314 (CDK2)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100468314 (CDK2)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100468314 (CDK2)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100468314 (CDK2)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100468314 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 100468314
NCBI-ProteinID: XP_002916102
Ensembl: ENSAMEG00000003168
UniProt: D2H336
LinkDB
Position
15
AA seq 298 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgctatacgagagatctctctgcttaaggagcttaaccac
cctaacattgtcaagctgctggatgtcatccacacagaaaacaaactgtacctggttttt
gagtttctgcatcaggatctgaagaaatttatggatgcctctgctttgactggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagccttctgccattcg
catcgggttctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc
atcaagctagcagactttggactagccagagcctttggagtccctgttcgtacttacacc
catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactac
tccacagctgtagatatctggagcctgggctgcatctttgctgagatggtgacccgccgg
gccctattccctggagattctgaaatcgaccaacttttccggatctttcggactctgggg
accccagatgaagtggtttggccaggagttacttctatgcctgattataagccaagtttc
cccaagtgggcccggcaagattttagtaaagttgttcctcccttggatgaagatggacgg
agcttgctatcgcaaatgctgcactacgaccccaacaagcggatttcggcaaaggcagct
ctggctcaccccttcttccaggatgtgaccaagccagtaccccaccttcgactctga

DBGET integrated database retrieval system