KEGG   Ailuropoda melanoleuca (giant panda): 100468516
Entry
100468516         CDS       T01329                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04010  MAPK signaling pathway
aml04071  Sphingolipid signaling pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04137  Mitophagy - animal
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04216  Ferroptosis
aml04218  Cellular senescence
aml04310  Wnt signaling pathway
aml04722  Neurotrophin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml05012  Parkinson disease
aml05014  Amyotrophic lateral sclerosis
aml05016  Huntington disease
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100468516 (TP53)
   04310 Wnt signaling pathway
    100468516 (TP53)
   04071 Sphingolipid signaling pathway
    100468516 (TP53)
   04151 PI3K-Akt signaling pathway
    100468516 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100468516 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    100468516 (TP53)
   04210 Apoptosis
    100468516 (TP53)
   04216 Ferroptosis
    100468516 (TP53)
   04115 p53 signaling pathway
    100468516 (TP53)
   04218 Cellular senescence
    100468516 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100468516 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100468516 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    100468516 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100468516 (TP53)
   05202 Transcriptional misregulation in cancer
    100468516 (TP53)
   05206 MicroRNAs in cancer
    100468516 (TP53)
   05205 Proteoglycans in cancer
    100468516 (TP53)
   05203 Viral carcinogenesis
    100468516 (TP53)
   05230 Central carbon metabolism in cancer
    100468516 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100468516 (TP53)
   05212 Pancreatic cancer
    100468516 (TP53)
   05225 Hepatocellular carcinoma
    100468516 (TP53)
   05226 Gastric cancer
    100468516 (TP53)
   05214 Glioma
    100468516 (TP53)
   05216 Thyroid cancer
    100468516 (TP53)
   05220 Chronic myeloid leukemia
    100468516 (TP53)
   05217 Basal cell carcinoma
    100468516 (TP53)
   05218 Melanoma
    100468516 (TP53)
   05219 Bladder cancer
    100468516 (TP53)
   05215 Prostate cancer
    100468516 (TP53)
   05213 Endometrial cancer
    100468516 (TP53)
   05224 Breast cancer
    100468516 (TP53)
   05222 Small cell lung cancer
    100468516 (TP53)
   05223 Non-small cell lung cancer
    100468516 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100468516 (TP53)
   05014 Amyotrophic lateral sclerosis
    100468516 (TP53)
   05016 Huntington disease
    100468516 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100468516 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100468516 (TP53)
   05161 Hepatitis B
    100468516 (TP53)
   05160 Hepatitis C
    100468516 (TP53)
   05162 Measles
    100468516 (TP53)
   05168 Herpes simplex virus 1 infection
    100468516 (TP53)
   05163 Human cytomegalovirus infection
    100468516 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100468516 (TP53)
   05169 Epstein-Barr virus infection
    100468516 (TP53)
   05165 Human papillomavirus infection
    100468516 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100468516 (TP53)
   01522 Endocrine resistance
    100468516 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100468516 (TP53)
   03036 Chromosome and associated proteins [BR:aml03036]
    100468516 (TP53)
   03400 DNA repair and recombination proteins [BR:aml03400]
    100468516 (TP53)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100468516 (TP53)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100468516 (TP53)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100468516 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 100468516
NCBI-ProteinID: XP_002924483
Ensembl: ENSAMEG00000016851
UniProt: G1MEP6
LinkDB
Position
17
AA seq 381 aa
MQDPQSELTIDPPLSQETFSELWNLLPENNVLSSELSPGVDELLLSEGVVNWMDEGSDDT
PRMPVAPAPAAPGPAISWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKL
FCQLAKTCPVQLWVNSPPPPDTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQ
HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTVHYNYMCNSSCMGGMNRRPIL
TIITLEDSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGEPSPELPPGSTKRALPPST
SCSPPQKKKPLDGEYFTLQIRGRERFNMFRELNEALELKDALSGKEPGGSRAHSSHLKAK
KGQSTSRHKKLMFKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcaggacccacagtcggagctcaccatcgacccccctctgagccaggagacattttcc
gaattgtggaacctacttcctgaaaacaatgttctgtcttccgagctgtccccaggagtg
gatgaactgctgctctcagaaggcgtcgtgaactggatggacgaaggttcagatgacact
cccaggatgccagtggctcctgcccctgcggcccctggaccagccatctcctggcccctg
tcatcctctgtcccttccccgaagacctaccctggcacctatgggttccgtctggggttc
ctgcattccgggacagccaagtctgttacttgcacgtactccccctccctcaacaagctg
ttttgccagctggcaaagacctgccccgtgcagctgtgggtcaactccccgcccccaccc
gacacctgcgtccgcgccatggccatttataagaagtcggagttcgtgacagaggttgtg
cggcgctgtccccaccatgagcgctgctctgacagtagtgatgggctggccccgcctcag
catctcatccgggtggaaggaaacttgcgtgccaagtacttggacgacagaaacactttc
cgacatagcgtggtggtgccctatgagccgcccgaggtcggctctgactgtaccaccgtc
cactataactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc
accatcatcaccctggaagattccagtggtaatgtgctgggacggagcagctttgaggta
cgtgtctgtgcctgtcctgggagagaccggcgcacagaggaggagaatttccgtaagaag
ggggagccttcccccgagctgccccccggaagcactaagcgagcactgcctcccagcacc
agctgctctcccccacaaaagaagaagccactggatggggaatatttcacccttcagatc
cgtgggcgtgaacgtttcaatatgttcagggagctgaatgaggccttggagctgaaggat
gccctgagtggcaaggagccgggggggagcagggctcactccagccacctgaaggctaag
aaggggcagtctacctcccgccataaaaagctgatgttcaagagagagggacccgactca
gactga

DBGET integrated database retrieval system