KEGG   Ailuropoda melanoleuca (giant panda): 100468835
Entry
100468835         CDS       T01329                                 

Gene name
USP7
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 7 isoform X1
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml05169  Epstein-Barr virus infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100468835 (USP7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100468835 (USP7)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100468835 (USP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100468835 (USP7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aml04121]
    100468835 (USP7)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100468835 (USP7)
Peptidases and inhibitors [BR:aml01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   100468835 (USP7)
Ubiquitin system [BR:aml04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100468835 (USP7)
SSDB
Motif
Pfam: USP7_ICP0_bdg USP7_C2 UCH UCH_1 MATH
Other DBs
NCBI-GeneID: 100468835
NCBI-ProteinID: XP_011223865
Ensembl: ENSAMEG00000010726
LinkDB
Position
10
AA seq 1086 aa
MAGNHKLGREAGDTDDPPRITQNPVINGNVAMSDGHNTTEEDMEDDTSWRSEATFQFTVE
RFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQA
VLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQ
ADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSV
PLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCV
EGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGD
NKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEF
LQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEH
NYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRK
ERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQNLSQTMGFP
QDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATL
PKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYE
EVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDV
IFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHN
YEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHG
CVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIP
LDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFE
KFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEK
AIKIHN
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggcggggaaccacaagcttggacgagaagctggagatacagatgacccaccaagaatt
actcagaaccctgttatcaacgggaatgtagccatgagtgatgggcacaacaccacagag
gaagatatggaggatgacacgagttggcgctccgaggcgacctttcagttcactgtcgag
cgcttcagcagactgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgcca
tggaagattatggtgatgccacgcttttatccagacagaccacaccaaaaaagcgtagga
ttctttctccagtgcaatgctgaatctgattccacgtcgtggtcttgccacgcacaggct
gtgctgaagataataaattacagagacgatgagaagtcgttcagccgacgcattagccac
ttgttcttccacaaggagaatgattgggggttttccaatttcatggcctggagcgaagtg
actgatcctgagaaaggatttatagatgatgacaaagttacttttgaagtctttgtacag
gcggatgctccccatggagttgcgtgggattcaaagaagcacacgggctatgtcggttta
aagaatcagggagcgacttgttacatgaacagcctgctgcagactttatttttcacaaat
caactacgaaaggctgtgtacatgatgccaacagagggtgatgattcatccaaaagcgtc
cccttagcattacaaagagtgttctacgaattacagcacagcgataaacctgtaggaaca
aaaaagctaacgaagtccttcgggtgggaaactttagatagcttcatgcagcacgacgtt
caagagctgtgtcgagtgttgcttgataatgtggagaataagatgaaaggcacgtgtgtg
gaaggcaccatacctaaattattcagaggcaaaatggtgtcctatatccagtgtaaagaa
gtagactaccgatccgacagaagagaagattattacgatatccagctaagtataaaagga
aagaaaaatatatttgaatcatttgtggattacgtggctgtggaacaactagatggtgac
aataaatatgacgccggggagcacggcttgcaggaagcagagaaaggtgtgaaattccta
actttgccaccagtgttacatctacagctgatgagatttatgtatgaccctcagacggac
caaaatatcaagatcaatgataggtttgaattcccagaacagttaccactcgatgaattt
ttgcaaaaaacagatcctaaggaccctgcaaattatattcttcatgcagtcctggttcac
agtggagataatcatggtggacattatgtggtttatctaaaccccaaaggggatggcaaa
tggtgtaagttcgacgatgacgtggtgtccaggtgtacgaaggaggaggccatcgagcac
aactacgggggccacgacgacgacctgtccgtgcggcactgcaccaacgcgtacatgctg
gtgtacatcagggagtccaagctcagtgaggttttacaagcggtcaccgaccacgacatc
cctcagcagttggtagagcgactccaggaggagaaaaggatcgaggcccagaagcggaag
gagcggcaggaagcccacctctacatgcaagtgcagatagttgcagaggaccagttttgt
ggccaccaaggaaatgatatgtatgatgaagaaaaagtgaaatacactgtgttcaaagta
ttgaaaaactcctcactggctgaatttgtccagaacctctctcagaccatgggattccca
caagatcaaattcgattatggcccatgcaggcgaggagcaacggaaccaagcggccagcg
atgttggataacgaggcagacggcaacaagacgatgattgagctgagtgataatgaaaac
ccatggacgatattcctggaaaccgtcgatccagagttggctgccagtggagccacgtta
cccaagtttgacaaagatcatgatgtcatgctgtttttgaagatgtatgaccccaaaaca
cggagcttgaattactgtgggcacatctacacgccaatatcctgtaaaatacgtgacttg
ctcccggttatgtgtgacagagcaggatttatccaagatactagccttatcctctatgag
gaagttaaaccgaatttaacagagagaattcaggactacgacgtgtctcttgataaagcc
cttgatgaactaatggacggtgacattatagtcttccagaaggatgaccctgaaaatgat
aacagtgaattacccactgcaaaagaatatttccgagacctctaccaccgtgttgatgtc
attttctgtgataaaacaatcccgaatgatcctggatttgtggttactttatcaaaccga
atgaattattttcaggttgcaaagacagtggcccagaggctcaacactgaccccatgttg
ctccagtttttcaagtctcaaggttatagggacggcccaggtaaccctcttagacataat
tatgaagggactttaagagatctcctacagttcttcaagcctagacaacctaagaaactt
tactatcagcagcttaagatgaaaatcacagactttgaaaacagacgaagttttaagtgt
atttggttaaacagccagtttagggaagaggaaataacactatatcccgataagcatggg
tgtgtccgggacctgctggaagaatgtaagaaggctgttgagctcggggagaaggcgtca
gggaaacttaggctgctagaaattgtaagctacaagattattggtgtgcaccaagaagac
gaactgctagaatgcttatctccagcgacgagtagaacgtttcgaatagaggaaatacct
ttggaccaggtggacatagacaaagagaatgagatgctcgtcaccgtggcgcacttccac
aaagaggtgttcgggacgttcgggattccgtttctgctgaggatacaccagggcgagcat
ttcagagaagtcatgaagcggattcagagtctgctagacatccaggaaaaggagtttgag
aagtttaaatttgccattgtgatgatgggccgacaccagtacataaacgaggatgagtat
gaagtgaacttgaaagactttgagccccagcctggtaacatgtctcatcctcggccttgg
ctagggctcgaccacttcaacaaagccccaaagaggagtcgctacacttacctggaaaag
gccattaaaatccataactga

DBGET integrated database retrieval system