KEGG   Ailuropoda melanoleuca (giant panda): 100468855
Entry
100468855         CDS       T01329                                 

Gene name
TLR3
Definition
(RefSeq) toll-like receptor 3 isoform X1
  KO
K05401  toll-like receptor 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04217  Necroptosis
aml04620  Toll-like receptor signaling pathway
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100468855 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100468855 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100468855 (TLR3)
   05160 Hepatitis C
    100468855 (TLR3)
   05171 Coronavirus disease - COVID-19
    100468855 (TLR3)
   05164 Influenza A
    100468855 (TLR3)
   05168 Herpes simplex virus 1 infection
    100468855 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100468855 (TLR3)
   05165 Human papillomavirus infection
    100468855 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:aml04054]
    100468855 (TLR3)
   04090 CD molecules [BR:aml04090]
    100468855 (TLR3)
Pattern recognition receptors [BR:aml04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100468855 (TLR3)
CD molecules [BR:aml04090]
 Proteins
  100468855 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR TIR_2 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 100468855
NCBI-ProteinID: XP_011228383
Ensembl: ENSAMEG00000005179
UniProt: D2HM22
LinkDB
Position
18
AA seq 905 aa
MNQSLPFHIYFFLGLLPFWILCTSSTNKCVVTHERADCSHLKLTQVPDDLPANITVLNLT
HNQLRRLPPANFTRYSQLTILDAGFNSISKLEPELCQKLPLLEILNLQHNELSHLSDQTF
VFCMNLTELHLMSNSIKDIQNNPFQNLKNLIKLDLSHNGLSSTKLGSQLQLENLQELLFS
NNKINILRPEELDFLGNSSLKKLELSSNPIKEFSPGCFHAIGKLFGLSLNNAQLTPSLTE
KLCVELSNTSIQNLSLSNTQLYRTSNMTFVGLNHTNLTMLDLSHNNLNVIENESLAWLPH
LEYFFLEYNNIEHLFSHSFYGLLNVRYLDLRRSFAKQSISLASHPKIDDFSFQWLKCLEY
LNMEDNNFPGINSNMFTGLIKLKHLSLSNSFASLRTLTNETFLSLAQSPLVTLNLTKNKI
SKIESGAFSWLSHLQVLDLGLNEIGQELTGQEWRGLENIVEIYLSYNKCLQLTSSSFALV
PSLRRLMLRRVALRNVDSSPSPFHPLRNLTLLDLSNNNIANINAELLEGLEKLEILDLQH
NNLARLWKHANPGGPVHFLKGLSHLHILNLESNGFDEIPAEVFKDLFELKSIDLGLNNLN
VFPPSVFDDQTSLKSLNLQKNLITSVQKNVFGPAFRSLSNLDMSFNPFDCTCESIAWFVN
WINRTHTSISELSSHYLCNTPPQYHGFPVMLFDVSPCKDSAPFELFFIINTSVSLIFIFI
VLLIHFEGWRISFYWNVLVHRILGFKEIDRQPEQFEYAAYIIHAYKDKDWVWEHFFPMEE
KDQTLKFCLEERDFEAGVLELESIVNSIKRSRKTIFVITQNLLKDPLCKRFKVHQAVQQA
IEQNLDSIILIFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERVNAFHHKLQVALGS
RNSIH
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgaaccagagtttaccttttcatatctacttctttttgggactgttgcccttttggata
ctgtgtacatcctctaccaataaatgtgttgttacacacgaaagagctgactgcagtcat
ctgaagttgactcaagtgcccgatgacctcccagcaaacataacagtgttgaatctcacc
cataatcagctcagaagattaccacctgccaattttacaagatatagccaacttactatc
ttggatgcaggatttaacagcatctcaaaactggaaccagaattgtgccaaaaactcccc
ctgttggaaattttgaacctccaacacaatgagctatctcatctttcagatcaaactttt
gtcttctgtatgaatttgactgaactccatctaatgtccaattcaatcaaggatattcaa
aataatccctttcaaaacctgaagaatttaatcaaattagacctatctcataatggttta
tcatctactaaattaggaagtcagctccaactggaaaatctccaagagcttctgttttca
aataataaaattaatatactgagacctgaagaacttgatttccttggtaattcttcttta
aaaaaattagagttgtcatcaaatccaattaaagagttctctccaggatgttttcatgca
atcggaaaattatttggcctctctctgaacaacgctcaactgacccccagcctcacagag
aagctttgcgtggaactgtcaaacacaagcattcagaatctatccttgagcaacacccag
ctgtacagaacaagcaatatgacttttgttggactaaaccacacaaatctcaccatgctc
gatctttcccacaataacttaaatgtgattgagaatgagtcccttgcttggcttccacat
ctagaatatttcttcctggagtataataatatagagcatttgttttctcactccttttat
gggcttctcaatgtgagatacctggatttgcgacgctcttttgctaaacaaagcatttcc
cttgcttcgcatcccaagattgatgatttttcctttcagtggctaaaatgtttggagtat
cttaacatggaagacaacaactttccaggcataaacagcaatatgttcacgggactgata
aagctgaaacacttaagtctctccaactccttcgcaagtttgcgaactttaaccaatgaa
acgtttttgtcccttgctcagtctcctttagtcacactcaatctaaccaaaaacaaaatc
tcaaaaatagagagcggtgccttttcttggttgagccacctacaggtactcgaccttggc
cttaatgaaatcgggcaagaactcacgggccaagaatggagaggtctagaaaatattgtt
gaaatctacctttcctacaacaaatgcctacaactgaccagcagctcttttgccttggtt
cctagcctccgacgactgatgctccgaagagtggcccttcgaaatgtggacagctcccct
tcaccttttcatcctcttcggaacttgactcttctggatctaagcaacaacaacatagcc
aacataaatgctgaactgttggagggtcttgagaagctagaaattctcgatttgcagcat
aacaacttagcaaggctatggaaacatgcaaaccctggtggtcctgttcattttctaaag
ggtctttctcacctccacattcttaacttagagtctaatggatttgatgagatcccagca
gaggtgttcaaggacttatttgaattaaagagcattgatctaggattgaataatttaaac
gtatttccaccatctgtctttgatgatcagacatctctaaagtcattgaaccttcagaag
aatctcataacatcagttcagaagaatgtttttgggccagccttcaggagcctgagtaat
ttagatatgagctttaatccatttgattgtacctgtgaaagtattgcctggtttgttaat
tggattaacaggacccataccagcatctctgaactatcaagccattacctctgcaatacc
ccacctcaatatcatggcttccccgtgatgctctttgatgtatcaccctgcaaagacagt
gctccctttgaactcttcttcataataaataccagtgtctcgttgatttttatctttatc
gtactgctcatccattttgaaggctggaggatatctttttattggaatgttttagtgcat
cgaattcttggtttcaaagaaatagacagacagccagagcagtttgaatatgcagcttat
ataattcatgcctataaagataaggattgggtctgggaacacttctttccaatggaagaa
aaagatcaaactctcaaattttgtctcgaagagagggactttgaggcaggtgtccttgaa
cttgaatcaattgttaatagcatcaagaggagcagaaaaactatctttgttataacacag
aacctattaaaagatccattatgcaaaagattcaaggtgcaccaagcagttcaacaagct
attgaacaaaatctggattccattatattgatctttcttgaggagatcccagattataaa
ctgaaccatgcactctgtttgcgaagagggatgtttaaatctcactgcatcttgaactgg
ccagttcagaaagaacgggtaaatgcctttcatcataaattgcaagtagcgcttggatcc
agaaattcaatacattaa

DBGET integrated database retrieval system