KEGG   Ailuropoda melanoleuca (giant panda): 100469232
Entry
100469232         CDS       T01329                                 

Gene name
ETV5
Definition
(RefSeq) ETS translocation variant 5
  KO
K15593  ets translocation variant 5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05202  Transcriptional misregulation in cancer
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100469232 (ETV5)
  09162 Cancer: specific types
   05215 Prostate cancer
    100469232 (ETV5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100469232 (ETV5)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100469232 (ETV5)
SSDB
Motif
Pfam: ETS_PEA3_N Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 100469232
NCBI-ProteinID: XP_034517474
Ensembl: ENSAMEG00000016732
LinkDB
Position
1
AA seq 510 aa
MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYSY
CAYDRKPPSGFKPLTPPTTPLSPTHQNSLFPPPQATLPTSAHAPAAGPVPGVGPAPAPHS
LPEAGPQQQTFAVPRPPHQPLQMPKMMPESQYPSEQRFQRQLSEPCHPFPPQSGVPGDNR
PNYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPTHGFQSPMGIKQEPRDYC
VDSEVPNCQSSYIRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGP
PYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLNEEDT
LPLTHFEDNPAYLLDMDRCSSLPYAEGFAY
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggatgggttttatgatcagcaagtcccttttatggtcccagggaaatctcgatcagag
gaatgtagagggcggcctgtgattgacagaaagaggaagtttttggacacagatctggcc
catgattccgaagagttgtttcaggatctcagtcaacttcaagaggcttggttagctgaa
gcacaagttcctgatgatgaacagtttgtcccagatttccagtctgataacttggtgctt
catgccccacctccaaccaagatcaaacgggagctgcacagcccctcctccgagctgtca
tcctgcagccacgagcaggctctcggtgctaactatggagaaaagtgcctctacagctat
tgtgcctatgataggaagcctccctctgggttcaagccattaacccctcccaccaccccc
ctgtcacccacccatcagaactccctgttccccccaccccaggccactctgcccacctct
gcacatgcccctgcagctggcccagtaccaggtgtgggccccgcccccgcccctcactcg
cttcctgaagctggaccacagcagcaaacctttgcggtcccccggccaccacatcagccc
ctgcagatgccaaagatgatgcctgaaagccagtatccatcagaacagagatttcagaga
caactgtctgaaccctgccaccccttccctcctcagtcaggagttcctggagataaccgc
cccaattaccaccggcaaatgtcagaacctattgtccctgcagctcccccgccccctcag
ggattcaaacaagaataccatgatccactctatgaacatggggtcccaggcatgccaggc
cccccaacacatgggttccagtcaccaatgggaatcaagcaggagccccgggattactgc
gttgattcagaagtgcctaactgccagtcgtcctatatcagagggggctatttctccagc
agccatgaaggtttttcatatgaaaaagatccccggttgtactttgacgacacttgtgtt
gttcctgagagactggaaggcaaagtcaaacaagagcccaccatgtatcgtgaggggccc
ccttaccagaggcgaggttctcttcagctgtggcagttcctggttaccctgcttgatgac
ccagccaatgcccacttcattgcctggacgggccgtggcatggagtttaagctgatagaa
cctgaggaggttgctcggcgttggggcatccagaagaaccggccagccatgaactatgac
aagctcagccgttctctacgctattactatgaaaagggcatcatgcagaaggtggcaggg
gagcgatacgtctataaatttgtctgtgacccggatgcccttttctccatggccttccct
gataaccagcgtccgttcctgaaagcagagtccgagtgtcacctcaacgaggaggatacc
ctgccactgacccactttgaagacaacccggcttacctcctggacatggatcgctgcagc
agcctcccctatgccgagggctttgcttactga

DBGET integrated database retrieval system