KEGG   Ailuropoda melanoleuca (giant panda): 100469346
Entry
100469346         CDS       T01329                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04015  Rap1 signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04068  FoxO signaling pathway
aml04150  mTOR signaling pathway
aml04270  Vascular smooth muscle contraction
aml04510  Focal adhesion
aml04650  Natural killer cell mediated cytotoxicity
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04726  Serotonergic synapse
aml04730  Long-term depression
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05034  Alcoholism
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100469346 (BRAF)
   04012 ErbB signaling pathway
    100469346 (BRAF)
   04015 Rap1 signaling pathway
    100469346 (BRAF)
   04068 FoxO signaling pathway
    100469346 (BRAF)
   04024 cAMP signaling pathway
    100469346 (BRAF)
   04150 mTOR signaling pathway
    100469346 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100469346 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100469346 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100469346 (BRAF)
   04062 Chemokine signaling pathway
    100469346 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100469346 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100469346 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100469346 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100469346 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100469346 (BRAF)
   04720 Long-term potentiation
    100469346 (BRAF)
   04730 Long-term depression
    100469346 (BRAF)
   04722 Neurotrophin signaling pathway
    100469346 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100469346 (BRAF)
   05205 Proteoglycans in cancer
    100469346 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100469346 (BRAF)
   05212 Pancreatic cancer
    100469346 (BRAF)
   05225 Hepatocellular carcinoma
    100469346 (BRAF)
   05226 Gastric cancer
    100469346 (BRAF)
   05214 Glioma
    100469346 (BRAF)
   05216 Thyroid cancer
    100469346 (BRAF)
   05221 Acute myeloid leukemia
    100469346 (BRAF)
   05220 Chronic myeloid leukemia
    100469346 (BRAF)
   05218 Melanoma
    100469346 (BRAF)
   05211 Renal cell carcinoma
    100469346 (BRAF)
   05219 Bladder cancer
    100469346 (BRAF)
   05215 Prostate cancer
    100469346 (BRAF)
   05213 Endometrial cancer
    100469346 (BRAF)
   05224 Breast cancer
    100469346 (BRAF)
   05223 Non-small cell lung cancer
    100469346 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100469346 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100469346 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100469346 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100469346 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100469346 (BRAF)
   05160 Hepatitis C
    100469346 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100469346 (BRAF)
   01522 Endocrine resistance
    100469346 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100469346 (BRAF)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100469346 (BRAF)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100469346 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100469346
NCBI-ProteinID: XP_019657798
Ensembl: ENSAMEG00000015264
LinkDB
Position
1
AA seq 765 aa
MAALSGGGGGGAEQDQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTS
SSSSSLSVLPSSLSVFQNPTDISRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASIAETALTSGSSPSAPPSDSTGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggcggcggtggcgcggagcaggaccaggctctgttcaac
ggggatatggagcccgaggccggcgccggcgccgcggcctcttcggctgcggaccctgcc
attcccgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaa
gccctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctat
gaagaatacaccagcaagctagatgccctccaacagcgagaacaacagttattggaatcc
ctggggaatggaactgatttttctgtttctagctctgcatcaacagacaccgttacatct
tcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccaca
gatatatcaaggagcaatcccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aataaacagaggacagtggtacctgcaagatgtggagttacagtccgagacagtctaaag
aaagctctgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaagat
ggagagaagaaaccaattggctgggacactgatatttcctggcttaccggagaggaacta
catgtagaagtgttggaaaatgttccacttaccacacacaactttgtacggaaaactttt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggttttcgctgtcaa
acatgtggttataagtttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaggaggcctccatagcagagactgcccttacgtctggatcatccccttctgctcccccc
tccgattctactgggccccaaattctcaccagtccgtctccttcaaaatccattccaatt
ccacagcctttccgaccagcagatgaagatcatcgaaatcaatttggacaaagagaccgg
tcctcatcagctccaaatgtgcatataaacacaatagaacctgtcaatattgatgacttg
attagagaccaagggtttcgtagtgatggaggatcaaccacaggtttgtctgccacccca
cctgcctcattgcctggctcactcactaatgtgaaagcattacagaaatctccaggacct
cagcgggaaaggaaatcatcttcatcctcagaagataggaatcgaatgaaaacacttggt
agacgggattcaagtgatgattgggagattcctgatgggcagatcacagtgggacagaga
attggatccgggtcatttgggacagtctacaagggaaagtggcatggtgatgtggcagtg
aaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagta
ggagtactcaggaaaactcgacatgtgaatatcctactcttcatgggctattcaacaaag
ccccaactagctattgttacccagtggtgtgagggctccagcttatatcaccatctccac
atcattgagaccaaatttgagatgatcaagcttatagatattgcacggcagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatt
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtgatccgaatgcaagataaaaacccatatagctttcagtcagatgtctatgcattt
gggattgttctatatgaattgatgaccggacagttaccttattcaaacatcaacaacagg
gatcagataatttttatggtgggacgaggatatctttctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattgatggcagagtgcctaaaaaagaaaagagat
gagaggccactctttccccaaattctcgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggcttccaaacagaggat
tttagtctatatgcttgtgcttctccaaaaacacccatccaggcagggggatatggagaa
tttgcagccttcaagtag

KEGG   Ailuropoda melanoleuca (giant panda): 100475955
Entry
100475955         CDS       T01329                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04068  FoxO signaling pathway
aml04270  Vascular smooth muscle contraction
aml04650  Natural killer cell mediated cytotoxicity
aml04720  Long-term potentiation
aml04726  Serotonergic synapse
aml04730  Long-term depression
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04928  Parathyroid hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05034  Alcoholism
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100475955 (ARAF)
   04012 ErbB signaling pathway
    100475955 (ARAF)
   04068 FoxO signaling pathway
    100475955 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100475955 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100475955 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100475955 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    100475955 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100475955 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100475955 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100475955 (ARAF)
   04720 Long-term potentiation
    100475955 (ARAF)
   04730 Long-term depression
    100475955 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475955 (ARAF)
   05205 Proteoglycans in cancer
    100475955 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100475955 (ARAF)
   05212 Pancreatic cancer
    100475955 (ARAF)
   05225 Hepatocellular carcinoma
    100475955 (ARAF)
   05226 Gastric cancer
    100475955 (ARAF)
   05214 Glioma
    100475955 (ARAF)
   05221 Acute myeloid leukemia
    100475955 (ARAF)
   05220 Chronic myeloid leukemia
    100475955 (ARAF)
   05218 Melanoma
    100475955 (ARAF)
   05211 Renal cell carcinoma
    100475955 (ARAF)
   05219 Bladder cancer
    100475955 (ARAF)
   05215 Prostate cancer
    100475955 (ARAF)
   05213 Endometrial cancer
    100475955 (ARAF)
   05224 Breast cancer
    100475955 (ARAF)
   05223 Non-small cell lung cancer
    100475955 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100475955 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100475955 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    100475955 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100475955 (ARAF)
   05160 Hepatitis C
    100475955 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100475955 (ARAF)
   01522 Endocrine resistance
    100475955 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100475955 (ARAF)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100475955 (ARAF)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100475955 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like Pkinase_fungal APH zf-RING-like TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 100475955
NCBI-ProteinID: XP_034505269
Ensembl: ENSAMEG00000012954
LinkDB
Position
X
AA seq 606 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNCRQFYHSVQDLSGGSRQHEAPSNRPLNEPL
TPQGPSSCTLHRDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTAAPMDSGLIQLTAQSFS
TDAAGSRGGGDGAPRGSPSPASVSSGRKSPHSKSPSEQRERKSVADDKKKVKNLGYRDSG
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRK
TRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRM
QDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSNCPK
AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
AARLVP
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaacggggctgagccgtcccgggcagtgggcact
gtcaaagtatacctgcccaacaagcaacgcacagtggtgactgtccgggatggcatgagt
gtctacgactctctagacaaggccctcaaggtccggggtctcaatcaggattgctgcgtg
gtctaccggctcatcaaggggcgaaagacagtcaccgcctgggacacagccattgccccc
ctggatggagaggagctcatcgtagaggtccttgaagacgtcccactgaccatgcacaat
tttgtacggaagacgttcttcagcctggcgttctgcgacttctgccttaagtttctgttc
cacggcttccgctgccaaacctgtggctacaagttccaccagcattgttcctccaaagtc
cccacagtctgtgttgacatgagcaccaactgccgacagttctaccacagtgtccaggat
ttgtccggaggctccagacagcacgaggctccctcgaaccgccccctgaatgagccgcta
acccctcagggtcccagctcctgcaccctgcaccgcgaccctgagcactttcccttccct
gcccctgccaacgccccactccagcgcatccgctccacgtccactcccaacgtccacatg
gtcagcaccgcagcccccatggactccggcctcatccagctcactgcccagagtttcagc
actgatgctgctggcagtagaggtggtggcgatggagccccccgggggagccccagcccg
gccagcgtgtcctcggggaggaagtccccccactccaagtctccatcggagcagcgggag
cggaagtccgtggccgatgacaagaagaaagtgaagaatctggggtaccgggactcgggc
tactactgggaggtgccacccagcgaggtgcagctgctgaagaggatcgggacgggctcg
ttcggcactgtgtttcgcgggcggtggcatggtgatgtggccgtgaaggtgctcaaggtg
gcccaacccacagctgagcaggcccaggccttcaagaacgagatgcaggtgctcaggaag
acacgtcatgtcaacatcctgctgttcatgggcttcatgacccggccgggatttgccatc
atcacacagtggtgtgagggctccagcctctaccaccacctgcatgtggctgacacacgc
ttcgacatggtccagctcatcgatgtggcccggcagactgcccagggcatggactacctc
catgccaagaacatcatccaccgagatctcaagtctaacaacatcttcctacatgagggg
ctcacagtgaagattggtgactttggcctggccacggtgaagacacggtggagtggggcc
cagcccttggagcagccctcaggctccgtgctgtggatggcggctgaggtgatccgtatg
caggacccgaacccctacagcttccagtcggatgtctacgcctatggggttgtgttgtat
gagctcatgaccggctcgctgccttacagccacattggcagccgtgaccagattatcttt
atggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaactgccccaag
gccatgcggcgcctgctctctgactgcctcaagttccagcgggaggaacgtcccctattc
ccccagatcctggccacgattgagctgctgcagcggtcactccccaagattgagcggagt
gcctccgaaccctccttgcaccgcacccaggctgatgagttgcctgcctgcctactcagc
gcagcccgccttgtgccttag

KEGG   Ailuropoda melanoleuca (giant panda): 100482255
Entry
100482255         CDS       T01329                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml04270  Vascular smooth muscle contraction
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04371  Apelin signaling pathway
aml04510  Focal adhesion
aml04540  Gap junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04613  Neutrophil extracellular trap formation
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04720  Long-term potentiation
aml04722  Neurotrophin signaling pathway
aml04726  Serotonergic synapse
aml04730  Long-term depression
aml04810  Regulation of actin cytoskeleton
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04926  Relaxin signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml04929  GnRH secretion
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05034  Alcoholism
aml05132  Salmonella infection
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100482255 (RAF1)
   04012 ErbB signaling pathway
    100482255 (RAF1)
   04014 Ras signaling pathway
    100482255 (RAF1)
   04015 Rap1 signaling pathway
    100482255 (RAF1)
   04370 VEGF signaling pathway
    100482255 (RAF1)
   04371 Apelin signaling pathway
    100482255 (RAF1)
   04630 JAK-STAT signaling pathway
    100482255 (RAF1)
   04068 FoxO signaling pathway
    100482255 (RAF1)
   04072 Phospholipase D signaling pathway
    100482255 (RAF1)
   04071 Sphingolipid signaling pathway
    100482255 (RAF1)
   04024 cAMP signaling pathway
    100482255 (RAF1)
   04022 cGMP-PKG signaling pathway
    100482255 (RAF1)
   04151 PI3K-Akt signaling pathway
    100482255 (RAF1)
   04150 mTOR signaling pathway
    100482255 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100482255 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    100482255 (RAF1)
   04218 Cellular senescence
    100482255 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100482255 (RAF1)
   04540 Gap junction
    100482255 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100482255 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100482255 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100482255 (RAF1)
   04625 C-type lectin receptor signaling pathway
    100482255 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    100482255 (RAF1)
   04660 T cell receptor signaling pathway
    100482255 (RAF1)
   04662 B cell receptor signaling pathway
    100482255 (RAF1)
   04664 Fc epsilon RI signaling pathway
    100482255 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    100482255 (RAF1)
   04062 Chemokine signaling pathway
    100482255 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100482255 (RAF1)
   04929 GnRH secretion
    100482255 (RAF1)
   04912 GnRH signaling pathway
    100482255 (RAF1)
   04915 Estrogen signaling pathway
    100482255 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    100482255 (RAF1)
   04917 Prolactin signaling pathway
    100482255 (RAF1)
   04921 Oxytocin signaling pathway
    100482255 (RAF1)
   04926 Relaxin signaling pathway
    100482255 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    100482255 (RAF1)
   04919 Thyroid hormone signaling pathway
    100482255 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    100482255 (RAF1)
   04916 Melanogenesis
    100482255 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100482255 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    100482255 (RAF1)
   04720 Long-term potentiation
    100482255 (RAF1)
   04730 Long-term depression
    100482255 (RAF1)
   04722 Neurotrophin signaling pathway
    100482255 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    100482255 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482255 (RAF1)
   05206 MicroRNAs in cancer
    100482255 (RAF1)
   05205 Proteoglycans in cancer
    100482255 (RAF1)
   05230 Central carbon metabolism in cancer
    100482255 (RAF1)
   05231 Choline metabolism in cancer
    100482255 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100482255 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100482255 (RAF1)
   05212 Pancreatic cancer
    100482255 (RAF1)
   05225 Hepatocellular carcinoma
    100482255 (RAF1)
   05226 Gastric cancer
    100482255 (RAF1)
   05214 Glioma
    100482255 (RAF1)
   05221 Acute myeloid leukemia
    100482255 (RAF1)
   05220 Chronic myeloid leukemia
    100482255 (RAF1)
   05218 Melanoma
    100482255 (RAF1)
   05211 Renal cell carcinoma
    100482255 (RAF1)
   05219 Bladder cancer
    100482255 (RAF1)
   05215 Prostate cancer
    100482255 (RAF1)
   05213 Endometrial cancer
    100482255 (RAF1)
   05224 Breast cancer
    100482255 (RAF1)
   05223 Non-small cell lung cancer
    100482255 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100482255 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100482255 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    100482255 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100482255 (RAF1)
   05152 Tuberculosis
    100482255 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100482255 (RAF1)
   05161 Hepatitis B
    100482255 (RAF1)
   05160 Hepatitis C
    100482255 (RAF1)
   05164 Influenza A
    100482255 (RAF1)
   05163 Human cytomegalovirus infection
    100482255 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100482255 (RAF1)
   05165 Human papillomavirus infection
    100482255 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100482255 (RAF1)
   01522 Endocrine resistance
    100482255 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100482255 (RAF1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100482255 (RAF1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100482255 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 100482255
NCBI-ProteinID: XP_011225822
Ensembl: ENSAMEG00000004650
UniProt: D2HGN5
LinkDB
Position
4
AA seq 648 aa
MEHIQGAWKTISNGFGFKDTVFDGPSCISPTIVQPFGFQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NSSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaacggttttggattcaaagacaca
gtgtttgacggccccagctgcatctcccctacaatagttcagccgtttggctttcagcgt
cgggcatcagatgatggcaaacttacggactcgtctaagacaagcaacactatccgtgtt
ttcttgccaaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagcttgcacgat
tgccttatgaaagcactcaaggtgaggggcctacagccggaatgctgtgctgtgttcaga
cttctccatgagcataaaggtaaaaaagcacgtttagattggaatactgatgccgcctcg
ttgattggagaagaacttcaagtagatttcctggatcatgttcctctcacaactcacaac
tttgcacggaagaccttcctgaagcttgccttctgtgacatctgtcagaagttcctgcta
aatggatttcgttgtcagacttgtggctataaatttcatgagcactgtagcaccaaagta
cctactatgtgcgtggactggagtaatatcagacagctcttattgtttccaaattctact
attggtgatagtggggtcccagcactgccttctttgacaatgcgtcgaatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccacgccttcacattc
aactcctccagcccttcctctgaaggttccctctcccagaggcagagatcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagccacagtgaatcagcctcaccttcagccttgtccagcagccctaacaatctg
agcccaacaggctggtcgcagcccaaaactcctgttccagcacagagagagcgggcacca
ggatctgggacccaggagaaaaacaaaatcaggcctcgtggacaaagagattcaagctat
tactgggaaatagaagccagcgaagtgatgctctccactcggattgggtcaggctccttt
ggaacagtgtataagggcaagtggcacggagatgttgcagtaaagatcctaaaggttgtc
gaccccaccccagagcagttccaggccttcaggaacgaggtggctgtcctccgcaaaaca
cggcacgtgaatatcctgctctttatggggtacatgacaaaggacaatctggcgattgtg
acccagtggtgtgaaggcagcagcctctacaaacacctgcatgtccaggaaactaaattc
cagatgttccagctgattgacatcgcccgccagactgctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaatcggagattttggtttggcaacagtaaagtcacgctggagcggttctcag
caggttgaacaacccactggctccgtcctttggatggcccccgaggtgatccgaatgcag
gataacaacccgttcagcttccagtccgatgtctactcctacggcattgtgctctacgag
ctcatgacaggggagcttccttactcccacatcaataaccgcgatcagatcatcttcatg
gtgggccgagggtacgcctccccagacctcagtaagctgtataagaactgccccaaagca
atgaagaggctcgtagccgactgtgtgaagaaggttaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgcttcaacactctctgccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccacactgaggatatcaacgcctgcacattgacc
acgtcccctagactgcctgtcttctag

DBGET integrated database retrieval system