KEGG   Ailuropoda melanoleuca (giant panda): 100469453
Entry
100469453         CDS       T01329                                 

Gene name
DDX58
Definition
(RefSeq) antiviral innate immune response receptor RIG-I
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:3.6.4.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04064  NF-kappa B signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05164  Influenza A
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100469453 (DDX58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100469453 (DDX58)
   04623 Cytosolic DNA-sensing pathway
    100469453 (DDX58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100469453 (DDX58)
   05160 Hepatitis C
    100469453 (DDX58)
   05171 Coronavirus disease - COVID-19
    100469453 (DDX58)
   05164 Influenza A
    100469453 (DDX58)
   05162 Measles
    100469453 (DDX58)
   05168 Herpes simplex virus 1 infection
    100469453 (DDX58)
   05169 Epstein-Barr virus infection
    100469453 (DDX58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:aml04054]
    100469453 (DDX58)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100469453 (DDX58)
Pattern recognition receptors [BR:aml04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   100469453 (DDX58)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD ResIII DEAD Helicase_C AAA_22 PTS_IIB
Other DBs
NCBI-GeneID: 100469453
NCBI-ProteinID: XP_002928312
Ensembl: ENSAMEG00000003766
UniProt: D2HZI2
LinkDB
Position
7
AA seq 928 aa
MSAEDRQNLHAFRDYVVKTLDPTYILSYMAPWFKDDKVQHIQAEKNNKGTTEAASLFLKF
LLELQEEGWFRGFLDALGHAGYSGLYEAIETWDFRKIESLEEYRLLLKRLQPEFKTTVNP
KDILPEISGCLISQECEEIIQVCSNKGLMAGAEKMAECLLRSDKENWPKTLKLALEIEES
QFSQLWIMDKDAKNVEPKVLEDDEIETSDIQIFYKEEPECQNLSQNPSPPSASPTFTQLK
PRNYQLELALPAKEGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFAIQLPV
YEQQKSVFSKYFEKLGYKVAGVSGATSEIVSVEEIVENYDIIILTPQILVNSLRKGTVPS
LSVFTLMIFDECHNTGKHHPYNMIMFNYLDQKLGGSSDPLPQVIGLTASVGTGDAKNTTE
AMEYICKLCASLDTSVIATVKDNLEELEEIVYKPQKFFRKVKLRTTDRFKCIISQLMRET
ESLAKKIFDELSTVTLENVFQIQNRNFGTQKYEQWILSVQKTCILFQLPDKEEESRICKA
LYLYTSHLRKYNDALIINEHARMKDALDYLKDFFANVRAAGFDEIEQHLTWRFEEKLREL
ESVSMDPGNENPKLQDLSFILQEEYHLNPESRTILFVKTRALVDALKKWIEENSELSFLK
PGILTGRGKTNQNTGMTLPAQKCALDAFRTDGDKKILIATSVADEGIDIAQCNLVILYEY
VGNVIRMIQTRGRGRARGSKCFLLTSNADVIEKEKINIHKEKMMNDSILRLQTWNEAVFK
EKVLQIQIQEKLIRDSQGKVERVPDKENKKLLCRKCKGFACYTADIRVVEDCHYTVVGDD
FRKCYVSKLHPKPKSFGYFEKTAKIFCSREDCSHDWGIHVKYKTFEIPVIKIESFVVEDI
ATGAQKLYAKWRDFPLQKIPFDAAEMSK
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgtcggctgaggatcggcagaatctgcacgccttccgggactatgtcgtgaagactctg
gaccctacgtacatcctgagctacatggccccctggtttaaggacgacaaggtgcagcat
atccaggctgagaaaaacaataagggcacgacagaggccgcctcactttttcttaagttc
ctattggagctccaggaagaaggctggttccgtggctttttggatgcccttggtcatgca
ggttattctggactttatgaagccattgaaacttgggatttccgaaaaattgaaagtcta
gaggagtacagattgcttttaaagcgtttacagccagaatttaaaaccacagttaatcca
aaagatatccttcctgaaatatctggatgtttaattagtcaggaatgtgaagaaatcata
caggtttgttccaacaaggggctgatggcaggtgctgagaaaatggccgaatgccttctc
agatcagacaaggaaaactggcccaaaactttgaaacttgctttggagatagaagagagc
cagttcagtcaactgtggattatggacaaagatgcaaaaaatgttgaaccgaaagtcctt
gaggatgatgaaatagaaacttctgacatacagattttctataaggaagaaccagaatgc
cagaatcttagtcagaacccatctccgccttcagcctctcctactttcacccaactgaag
ccaagaaattaccaacttgagctcgcgttgcctgctaaggaaggaaaaaacacaataata
tgtgctcctactggttgtggaaaaacctttgtttcccttcttatatgtgaacatcatctt
aaaaaatttccacaaggacaaaaagggaaggttgttttttttgctattcagctccccgtg
tatgaacagcagaaatccgtgttctccaaatattttgaaaaacttgggtacaaagttgca
ggtgtttctggagcaacatctgagattgtctcagtggaagagattgttgagaactatgac
atcatcattttaactccacagattcttgtgaatagtcttagaaaagggactgttccatca
ctctctgtctttactttgatgatatttgatgaatgtcacaacaccggtaaacaccatcct
tacaatatgatcatgtttaattatctggatcagaaacttggaggatcttcagacccactg
cctcaggtcattgggctgactgcctcggttggcactggggatgccaaaaacacaacagaa
gccatggaatatatctgcaaactgtgtgcttctcttgacacatcagtgatagcaacagtc
aaagacaacttggaagaattggaagaaattgtttataagccccagaagtttttcaggaaa
gtgaaattacggactactgacagatttaaatgcatcatatctcagctgatgagggaaaca
gagagtctggcaaagaagatctttgacgagctcagtaccgtaactctcgaaaatgtattt
caaattcaaaataggaattttggaacacagaaatacgaacaatggatcctttctgttcag
aaaacatgcattttgtttcagttgcccgacaaagaagaggagagcaggatttgtaaagcc
ctgtatttgtacacttcccacttgcggaaatataatgatgccctcattatcaatgagcat
gcccggatgaaagatgctctggattacttgaaagacttcttcgctaatgtccgagcagca
ggatttgatgagattgagcagcatctcacctggagatttgaagaaaaactgagggaactg
gaaagtgtttcaatggatcccggcaacgagaaccctaaactccaagatctctcctttatc
ttgcaagaggagtaccacttaaacccagagagtagaaccatcctctttgtgaaaaccaga
gcacttgtggatgctttgaagaaatggattgaagaaaattctgaactcagctttctaaaa
cctggcatattgactggacgtggcaaaacaaatcagaacacagggatgacgctcccagcg
cagaagtgtgcgttggatgcattcagaaccgatggcgataagaagattctgattgccacc
tccgttgccgatgagggcatcgacattgcacagtgtaacttggtcatcctgtatgagtat
gtgggcaatgtcatcagaatgatccaaaccagaggcagaggaagagcaagaggtagcaag
tgcttccttctgaccagcaatgctgatgtaattgaaaaagaaaaaataaacatacataaa
gaaaaaatgatgaatgactccattttaaggcttcagacgtggaatgaagcagtatttaaa
gaaaaggttctccagatacagattcaagaaaaactcatcagggatagtcaaggaaaagta
gaacgtgtacctgataaggaaaataaaaaactgctctgcagaaagtgcaagggctttgcg
tgttacacagctgacatcagagtggtggaggactgccattacactgtggttggagatgat
tttaggaagtgctatgtgagtaaattacaccccaaaccaaagagctttgggtatttcgag
aagacagcaaagatcttctgttccagagaggactgcagccatgactggggaatccatgtg
aagtacaagacatttgagattccagttataaaaatagaaagctttgtggtggaagatatt
gctactggagctcagaaactatatgcaaagtggagggactttcctttgcagaagataccc
tttgatgctgcagaaatgtccaaatga

DBGET integrated database retrieval system