KEGG   Ailuropoda melanoleuca (giant panda): 100469592Help
Entry
100469592         CDS       T01329                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00250  Alanine, aspartate and glutamate metabolism
aml00280  Valine, leucine and isoleucine degradation
aml00410  beta-Alanine metabolism
aml00640  Propanoate metabolism
aml00650  Butanoate metabolism
aml01100  Metabolic pathways
aml04727  GABAergic synapse
Module
aml_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100469592 (ABAT)
   00650 Butanoate metabolism
    100469592 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100469592 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    100469592 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100469592 (ABAT)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100469592 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aml01007]
    100469592 (ABAT)
Enzymes [BR:aml01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100469592 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100469592 (ABAT)
Amino acid related enzymes [BR:aml01007]
 Aminotransferase (transaminase)
  Class III
   100469592 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 100469592
NCBI-ProteinID: XP_011223873
Ensembl: ENSAMEG00000010830
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MAFMLLSRRLACTFQHNYCLLAPSSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASTFINRPALGILPPENFVEKLQESLLSVAPKGMSQLITMSCGSCSNENAFKTIFMWYR
SKERGQTGFSKEELETCMINQAPGCPEYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLADPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNATHAGKALLMGLL
DLQARYPQFISRVRGRGTFCSFDTPDETIRNKLILMARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccttcatgttgctcagccggcggctggcctgcacctttcagcacaactactgcctg
ctcgcacccagctccagacacatcagtcaggccgcagccaaagttgacgtcgaatttgat
tatgatgggcccctgatgaagactgaagtcccagggcctagatctcgggagttaatgaaa
cagctgaatataattcagaatgcagaggcggtgcactttttctgcaattatgaagagagc
cgaggcaattacctggtcgatgtggatggcaaccggatgttggacctttactcccagatt
tcctctgtccccataggctacagccaccctgctctcctgaagctgatccaacagcctcaa
aatgcgagtacgttcatcaacagacctgcccttggaatccttcctccggagaacttcgtg
gagaagcttcaggagtccttgctctcggtggctcccaaagggatgtcccagctcatcacc
atgtcctgcggctcgtgctccaacgaaaatgcctttaagacaatcttcatgtggtaccgg
agcaaggaaaggggtcaaacgggtttctccaaagaggagctggagacgtgcatgatcaac
caggcccccggctgccccgagtacagcatcctctccttcatgggcgcgttccacgggagg
accatgggatgcttagcaaccacgcactccaaagctattcacaagatcgacatcccttcc
ttcgactggcccattgcaccattcccacggctgaaataccctctggaagagtttgtgaaa
gagaaccagcaggaagaagcccgctgtctggaagaggtggaggatctgattgtgaaatat
cggaaaaagaaaaagacggtggccgggatcatcgtggagcccatccagtctgagggtgga
gacaaccacgcgtccgacgacttcttccggaaactgagagacatctccaggaagcatggc
tgtgctttcttggtggacgaggtccagacgggaggaggctgtactggcaagttctgggcc
cacgagcactggggtttggccgaccctgcggacgtgatgaccttcagcaagaagatgatg
accgggggcttcttccacaaggaggagttcaggcccaatgctccgtaccggatctttaac
acctggctgggggacccatccaagaacctgctgctggccgaggtcatcaacatcatcaag
cgggaggacctgctgaacaacgcaacgcatgccgggaaggccctgctgatggggctgctg
gacctccaggcccggtacccccagttcatcagcagagtgagaggacgaggcaccttttgc
tccttcgacactccagatgaaaccatacggaataaactcattttaatggccagaaacaaa
ggcgtggtgttgggaggctgcggggacaaatccattcggttccgccccactctggtcttc
agagatcaccacgcacacctgttcctcaatattttcagcgacatcttagctgacttcaag
taa

DBGET integrated database retrieval system