KEGG   Ailuropoda melanoleuca (giant panda): 100469683
Entry
100469683         CDS       T01329                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04012  ErbB signaling pathway
aml04217  Necroptosis
aml04630  JAK-STAT signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04917  Prolactin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05161  Hepatitis B
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100469683
   04630 JAK-STAT signaling pathway
    100469683
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100469683
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100469683
   04659 Th17 cell differentiation
    100469683
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100469683
   04935 Growth hormone synthesis, secretion and action
    100469683
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100469683
   05203 Viral carcinogenesis
    100469683
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100469683
   05220 Chronic myeloid leukemia
    100469683
   05223 Non-small cell lung cancer
    100469683
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100469683
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100469683
   05161 Hepatitis B
    100469683
   05162 Measles
    100469683
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100469683
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100469683
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100469683
NCBI-ProteinID: XP_034496585
Ensembl: ENSAMEG00000006086
LinkDB
Position
13
AA seq 806 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAGLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVVSGICVLSSQDRR
STSQAARGARERARARKRTGPGRRRPDPSFLCGGAREVRERGRPAYAGAWSPAPPPERGL
QGCSLGAQKGLLSPPPHPGGGGTGPCPLSQRHVWSGPLCPRSTFIIEKQPPQVLKTQTKF
AATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQA
TGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVV
IVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKE
NLVFLAQKLFNSSTSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH
WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTT
RDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVS
ASADSAGASATYMDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELL
RRPMDSLDPRLSPPAGLFTAARGSLS
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaagcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ctgtatgggcagcacttccccatcgaggttcggcactacttggcgcagtggatcgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgagcccaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaagtcggggaagatggg
ttcttgctgaagatcaagctggggcattatgccacgcagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccgacacattctgtacaatgaacagaggctggtg
cgagaagccaacaacgggagttctccggctgggatcctggttgacgccatgtcccagaag
cacctccagatcaaccagacgtttgaggagctgcgactggtcacccaggacacggagaac
gagctgaagaagctgcagcagactcaagagtacttcatcatccagtatcaggagagcctg
aggatccaagctcagttcgccgggctggcccagctgaatccccaggagcgtctgagccgg
gagacggccctccagcagaagcaagtgtccctggaggcctggctgcagcgtgaggcccag
acgctgcagcagtaccgtgtggtaagtgggatctgcgtcctctcctcccaggatcggagg
tccacgtcccaagctgcccggggagcccgcgagagggctagggccaggaagagaacggga
cccgggagaaggaggccggatccctctttcctttgtgggggggcacgtgaggttcgggag
aggggaaggcctgcctatgctggggcctggtccccagccccgcctcccgagcgaggcctg
caaggctgttctctgggagcccagaagggcctgctgtccccacctccccaccccgggggg
ggggggaccgggccctgtcccctgagccagcgtcatgtgtggtctggtcccttgtgtccc
cgcagcacattcatcattgagaagcagccccctcaggtcctgaagacccagaccaagttt
gcagcgacggtgcgcctgctggtgggtgggaagctgaatgtgcacatgaaccccccgcag
gtgaaggccaccatcatcagcgagcagcaggccaagtcgctgctcaagaacgagaacacc
cgcaacgagtgcagcggcgagatcttgaacaactgctgtgtgatggagtaccaccaggcc
actggcaccctcagcgcgcacttcaggaacatgtcactgaagaggattaagcgtgctgac
cgcaggggcgcggagtctgtgacggaagagaagttcacagtcctgtttgagtctcagttc
agtgttggcagcaatgagctcgtgttccaggtgaagactctgtcccttcccgtggttgtc
attgttcacggcagccaggaccacaacgcgactgccaccgtgctgtgggacaacgccttt
gctgagccgggcagggtgccattcgcggtgcccgacaaagtgctgtggccgcagctgtgt
gaggcgctcaacatgaaattcaaggctgaagtgcagagcaaccggggcctgaccaaggag
aacctcgtgttcctggcacagaaactgttcaacagcagcaccagccaccttgaagactat
aatggcatgtccgtgtcctggtcccagttcaacagggagaacttgccgggctggaactac
accttctggcagtggttcgatggggtcatggaggtgctgaagaagcatcacaagccccat
tggaatgacggggccatcctaggttttgtgaataagcaacaggcccatgacctgctcatc
aacaagcccgatgggacctttttattgcgctttagcgactccgaaatcgggggcatcacc
attgcctggaagtttgactctcctgaccgcaacctgtggaacctgaagccattcaccaca
cgggacttctccattcggtcgctggctgaccggctgggggacctgagctatctcatctac
gtgtttccggaccggcccaaggatgaggtcttctccaagtactacacccctgtgcttgct
aaagcggtggacggatacgtgaagccacagatcaagcaagtggtccctgagtttgtgagc
gcgtctgcggactctgccggggccagcgccacctacatggaccaggccccctccccggcc
gtgtgcccccaggctcattataacatgtacccccagaaccctgaccccgtcctcgaccag
gatggagaatttgacctggatgagaccatggacgtagcccggcacgtggaggaactctta
cgccgcccaatggacagtctggacccccgtctctccccacctgctggtcttttcactgcc
gcccgaggctcgctgtcgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100479246
Entry
100479246         CDS       T01329                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04012  ErbB signaling pathway
aml04062  Chemokine signaling pathway
aml04217  Necroptosis
aml04630  JAK-STAT signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04917  Prolactin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05161  Hepatitis B
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100479246
   04630 JAK-STAT signaling pathway
    100479246
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100479246
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100479246
   04659 Th17 cell differentiation
    100479246
   04062 Chemokine signaling pathway
    100479246
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100479246
   04935 Growth hormone synthesis, secretion and action
    100479246
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479246
   05203 Viral carcinogenesis
    100479246
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100479246
   05220 Chronic myeloid leukemia
    100479246
   05223 Non-small cell lung cancer
    100479246
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100479246
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100479246
   05161 Hepatitis B
    100479246
   05162 Measles
    100479246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100479246
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100479246
SSDB
Motif
Pfam: STAT_bind STAT_int SH2 STAT_alpha
Other DBs
NCBI-GeneID: 100479246
NCBI-ProteinID: XP_034496579
Ensembl: ENSAMEG00000006061
LinkDB
Position
13
AA seq 632 aa
MKQDSLILQYQSRAHNFKGIETMAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWI
ESQAWDSIDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTY
DRCPMELVRCIRHILYNEQRLVREANNGTSPVGSLADAMSQKHLQINQTFEELRLVTQDT
ENELKKLQQTQEYFIIQYQESLRIQGEAPAVCHEGATIISEQQAKSLLKNENTRNDYSGE
ILNNCCVMEYHQATGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNEL
VFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKF
KAEVQSNRGLTKENLVFLAQKLFNSSTSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFD
GVMEVLKKHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDS
QERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCEPAAAKA
VDGYVKPQIKQVVPEFVSVSADSAGASATYMDQAPSPAVCPQAHYNMYPQNPDPVLDNDG
DFDLDDTMDVARRVEELLGRPMDSQWIPHAQS
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgaagcaggattccttgattttgcaataccagagcagagcacataattttaaaggaatt
gaaaccatggctgtgtggatacaagcccagcagctccaaggcgacgcgcttcatcagatg
caagcattatatggtcagcatttccccattgaggtgcgacattatttatcccaatggatt
gaaagccaagcgtgggactcaatagatcttgataatccacaggagaacattaaggccacc
cagctcctggagggcctggtgcaggagctgcagaagaaggcagagcaccaagtcggggaa
gatgggttcttgctgaagatcaagctggggcactatgccacgcagctccagaacacgtac
gaccgctgccccatggagctggtccgctgcatccgacacattctgtacaatgaacagagg
ctggtgcgagaagccaacaacggtacttctccagttggaagtcttgctgacgccatgtcc
cagaagcacctccagatcaaccagacgtttgaggagctgcgactggtcacccaggacacg
gagaacgagctgaagaagctgcagcagactcaagagtacttcatcatccagtatcaggag
agcctgaggatccagggtgaggccccggcagtgtgtcacgagggcgccaccatcatcagc
gagcagcaggccaagtcgctgctcaagaacgagaacacccgcaatgactacagtggcgag
atcttgaacaactgctgtgtgatggagtatcaccaggccaccggcaccctcagcgcgcac
ttcaggaacatgtccctgaaacgaattaagagatctgaccgtcgtggagcagagtcagtg
acagaagaaaaatttacaatcctgtttgaatcacagttcagtgttggtggaaatgagctg
gtttttcaagtcaagaccctgtccctcccagtggtggtgatcgttcatggtagccaggac
aacaacgcgacggccaccgttctctgggacaatgcttttgcagagcctggcagggtgcca
ttcgctgtgcccgacaaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattc
aaggctgaagtgcagagcaaccggggcctgaccaaggagaacctcgtgttcctggcacag
aaactgttcaacagcagcaccagccaccttgaagactataatggcatgtccgtgtcctgg
tcccagttcaacagggagaatttaccaggacgaaattacacgttctggcagtggttcgat
ggtgtgatggaagtgttaaaaaaacatctcaagcctcattggaatgatggggctattttg
ggttttgtgaacaagcaacaggcccatgacctactcattaacaagcctgatgggaccttc
ctgttgagattcagcgactctgaaattggtggcatcaccattgcttggaagtttgattct
caggaaagaatgttttggaacctgatgccctttaccaccagagacttctccatccggtcc
ctggctgaccgcttaggggacctgaattaccttatctatgtgtttcctgatcggccaaaa
gatgaagtgtactccaagtattacacaccagttccatgcgagcctgccgccgctaaagcg
gtggatggatacgtgaagccgcagatcaagcaagtggtccctgagtttgtgagcgtgtct
gcggactctgctggggccagcgccacctacatggaccaggccccctccccggccgtgtgc
ccccaggctcattataacatgtacccccagaaccctgaccctgtccttgacaacgatggg
gactttgatctggacgacacaatggatgtggcccggcgtgtggaggagctcctcggccga
ccaatggacagccagtggatccctcacgcgcagtcgtga

DBGET integrated database retrieval system