KEGG   Ailuropoda melanoleuca (giant panda): 100469731Help
Entry
100469731         CDS       T01329                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00052  Galactose metabolism
aml00500  Starch and sucrose metabolism
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100469731 (GANC)
   00500 Starch and sucrose metabolism
    100469731 (GANC)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100469731 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100469731
NCBI-ProteinID: XP_019657449
Ensembl: ENSAMEG00000015989
LinkDB All DBs
Position
Un
AA seq 936 aa AA seqDB search
MEATGKEEISVEDEAVDKNIFKDCSKIAFYRRQKQQLSRRSMYQASLDSATTGKDSTKFQ
IINETTKVPLVAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKPSTVRLISCAGDADS
LVLADGKGDLKCHITANPFKIDLVSEEEVVMSINSLGQLYFEHLQIPLKQRATKENKEDT
SVDTSQEDQEDLGLWEEKFGKFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
SDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKPGRTLGIFWLNASETLVEINTEPAV
KYTLTQMGPAAAKQKVRCRTDVHWMSESGIIDVFLLTGPTPSDVFGQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPRR
MQELLRSKNRKLVVISDPHIKIDPDYSVYVKAKEQGFFVRNHEGGDFEGVCWPGLSSYLD
FTNPKVREWYSGLFTFSAYQGSTDILYIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
ENTQLIREAIRQRYALLPYWYSLFYRAHVAAQPVMRPLWIEFPEELDTFGVEDEYMLGSA
LLVHPVTEPKASTVDVFLPGSNEVWYDSKTFALWEGARTVKFPVALDTIPVFQRGGSIVP
IKTTLGKSTGCMTDSPYGLRVALSTKDSAMGEFYLDDGHSFQYLHQKQFLHRKFSFLSGV
LINSCADKRGHYPSKCVVEQIFVLGLKKQPSSVTTRSSDKWTLHFLMEVRYTGIQREQGH
PAASHQLGFLQTMVKMSLWLLHIVPKCPPCIWRSSH
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggaagctactgggaaagaggaaatcagtgttgaagatgaagctgtggacaaaaacatt
ttcaaagattgcagcaagattgctttctacaggcgtcagaaacagcagctgtccaggaga
tccatgtatcaggcatcactagactcagccacaacaggcaaagacagcaccaagttccaa
atcatcaatgaaacaaccaaggttcctcttgtggctgaagtttatggtatagagggaaat
attttcaggcttaaaatcaatgaagaaactcccctgaaacccagatatgaagttcccgat
gtcctcacaagcaagcccagcactgtaaggttgatttcatgtgcaggggatgcagatagt
ctggtactggcagatggaaaaggagatctgaagtgtcatatcacagcaaacccattcaag
atagatttggtgtctgaagaagaggttgttatgagcataaactccctgggccaattgtac
tttgagcacctgcagattcctctcaagcaaagagctaccaaagaaaataaggaggacaca
tcagttgacacttctcaggaagaccaagaggatctgggcctgtgggaggagaaattcgga
aaatttgtggatgtcaaagtgaatggtcctgcctccattggtttggatttctccttgcat
ggatttgagcatctctacgggatcccacaacatgcagaatcacaccaacttaaaaatact
agtgatggtgatgcttaccgtctttataacttggatgtatatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaaccaggcaggactcta
ggcattttttggctcaatgcctccgaaacactagtggagatcaatacagagcctgcagta
aagtacacactgacccagatgggccctgctgcagctaaacaaaaggtcagatgtcgaact
gatgtgcactggatgtcagagagtggaatcattgatgtttttctgctgacaggacctacg
ccttctgatgtcttcgggcagtactcataccttacaggcacccaagccatgcccccgctc
ttctccttggggtaccatcagtgccgctggaactatgaggatgagcaggacgtaaaagca
gtggatgcaggatttgatgaacatgacattccttatgatgtcatgtggctggacatagag
cacaccgagggcaaaaggtacttcacttgggacaagaaaagattcccaaaccccagaagg
atgcaagagctgcttagaagcaaaaaccgtaagcttgtggtcatcagtgacccccacatc
aagattgatcctgactattcagtgtacgttaaggccaaagaacagggattctttgtgagg
aatcatgaaggaggagactttgaaggggtatgctggcctggtctctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcagggcttttcacgttctctgcttatcag
ggatctactgacatcctctacatatggaacgacatgaatgagccctccgtctttagaggg
ccagagctaaccatgcagaagaatgccattcatcatggcaattgggagcacagggaactt
cacaacatctatggtttctatcagcaaatggctactgcagaaggactgatacaacgatct
aaggggaaggagagaccctttgttcttacacgttctttctttgctggatcacagaagtat
ggtgctgtgtggaccggggacaacacagcagaatggagctacctgaaaatttccatccct
atgttactcaccctcagcattactgggatctctttttgtggagcggacgtaggcggcttc
attgggaatccagaggcggagctgctagtgcggtggtaccaggctggagcctaccagccc
ttcttccgtggccacgctaccatgaacaccaagcggcgggaaccctggctctttggggag
gaaaacacgcagctcatccgggaagccatccggcagcgctacgccctcctgccctactgg
tattctctcttctaccgcgcacacgtggctgcccaacccgtcatgagacctctgtggata
gagttcccagaggaattagacacttttggtgtggaagatgaatacatgctgggaagtgct
ttattggttcatccagtcacagaaccaaaagccagcacagttgatgtgtttctgccagga
tcaaatgaggtctggtatgactctaaaacatttgctctttgggaaggagcacgaactgtg
aagttccctgtagccttagacaccataccagtatttcagcgaggtggaagtatagtacca
ataaagacgactctaggaaaatccacaggctgcatgactgattccccatatggactcagg
gtggccctaagcacgaaggattctgccatgggtgaattctatctcgacgacggccattca
ttccagtacctccaccagaagcagttcttgcacaggaagttttcattcttgtcgggtgtt
ttgatcaacagttgtgctgacaaaagaggtcattatcccagcaagtgtgtggtggagcag
atctttgtcctaggcctcaagaagcagccatcttctgtgaccacccgttcatctgacaag
tggaccctgcactttctgatggaggtcagatatactggtatccagagggagcaaggccat
cctgctgcttctcatcagctgggctttctgcaaactatggtaaagatgagcctgtggctt
ttacatattgtgcccaaatgtccaccctgcatctggagaagctctcactga

DBGET integrated database retrieval system