KEGG   Ailuropoda melanoleuca (giant panda): 100469823
Entry
100469823         CDS       T01329                                 

Gene name
GAB2
Definition
(RefSeq) GRB2-associated-binding protein 2 isoform X6
  KO
K08091  GRB2-associated-binding protein 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04014  Ras signaling pathway
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04380  Osteoclast differentiation
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100469823 (GAB2)
   04072 Phospholipase D signaling pathway
    100469823 (GAB2)
   04071 Sphingolipid signaling pathway
    100469823 (GAB2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    100469823 (GAB2)
   04666 Fc gamma R-mediated phagocytosis
    100469823 (GAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100469823 (GAB2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100469823 (GAB2)
Domain-containing proteins not elsewhere classified [BR:aml04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   100469823 (GAB2)
SSDB
Other DBs
NCBI-GeneID: 100469823
NCBI-ProteinID: XP_011219385
LinkDB
Position
8
AA seq 576 aa
MKPLILLTNIQFTGRPVMGIHFGDSLRNLSSASHGPRSSPAELSSSSQHLLRERKSSAPS
HSSQPTLFTFEPPVSNHMQPALSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMR
SDTAVQKLAQGNGHCVNGVSGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSL
TGSETDNEDVYTFKTPSNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMAVA
TPGDSAIAPPPRPPKPSQAETPRWGSPQQRPPINESSRSISAAATIPRRNTLPAMDNSRL
HRASSCESYEYPQRGGDSAGRSAESVSDAVTSFLPGKTIVGRSESTNSEDNYVPMNPGSS
TLLATERAGDNSQSVYIPMSPGPHHFEGLSYPSTALSMHRGPSRGSEIQPPPVNRNLKPD
RKVKPTPLDLRNNTVIDELPFKSPVTKSWSRAIHTFNCSSSQYCRPISTQSITSTDSGDS
EENYVPMQNPVSASPIPSGTNSPAPKKSTGSVDYLALDFQPGSPSPHRKPSTSSVTSDEK
VDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgaagccattgattctgctaacaaacatccagttcactggaagacctgtaatgggaatt
cattttggagactccctgagaaacctctcctccgccagtcatggcccccgctcttctcca
gctgagctcagcagctccagtcagcaccttctccgagagcggaagtcctcggccccatcg
cactccagccagcccaccctgttcacctttgagcccccggtgtcaaaccacatgcagcct
gccttgtccaccagtgcgcctcaggaatatctctacttgcatcagtgcatcagccggaga
gcggaaaacgccaggagtgccagcttctctcagggcacgagggcctcgtttctcatgagg
agcgacacagccgtacagaagcttgcccagggcaacggacactgtgtcaacggcgtcagt
ggtcaagtccatggcttctatagcctccccaagccaagccggcacaatacggaattcaga
gacagtacctacgacctgccccggagcctggcctcccacggccacaccaagggtagcctc
acaggctctgagaccgataacgaggacgtatacaccttcaagacgcccagcaacaccctg
tgtcgggagtttggggacctcctagtggacaatatggacgttccagccaccccgctctca
gcctaccagatccctaggacgttcacgctggacaagaaccataatgccatggcagtggcc
actcctggggactcggccatcgctcccccgccccggcctcccaagccaagtcaggcagaa
acacctcgatggggcagccctcaacagagacctccaatcaatgagagcagcagatccatc
tctgccgcggccaccatccccaggcgcaacaccctcccagccatggacaacagccgactg
caccgagcttcttcctgtgagtcctacgagtacccgcagcgcggtggagacagtgcaggc
cggtctgccgagtccgtgagtgatgcggtcacttctttcctgccagggaaaaccattgtg
ggccggtcagagagcaccaattccgaggacaactatgtgcccatgaatccagggtcctcc
accctgctggccacggagcgagcaggcgataactcccagagtgtctacatccccatgagc
ccaggaccccaccactttgaggggcttagctacccctcaacagccctttctatgcaccgg
ggccccagccgagggagtgagatccagccaccgcctgtcaaccgcaacctcaaacctgac
cggaaagtaaagccaacaccactggacctgagaaacaacactgtcatcgatgagctcccc
ttcaagtcacctgtcaccaagtcttggtctagggccatccacaccttcaactgcagctcg
tcccagtactgccgccccatctccacccagagcatcaccagcacggactccggagacagc
gaagagaactatgtccctatgcaaaatccagtgtctgcatctcccattcccagtggcacc
aacagtcccgccccaaagaagagcacgggcagcgttgattacctggccctggacttccag
ccaggctcccccagtccccaccgcaagccatccacgtcatccgtcacttccgatgagaag
gtggactacgttcaggtggacaaggagaaaacccaggccctgcagaacaccatgcaggag
tggacagatgtgcggcagtcctcggagccttccaagggcgctaagctgtga

DBGET integrated database retrieval system