KEGG   Ailuropoda melanoleuca (giant panda): 100469856
Entry
100469856         CDS       T01329                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04072  Phospholipase D signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04640  Hematopoietic cell lineage
aml04916  Melanogenesis
aml05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100469856 (KITLG)
   04014 Ras signaling pathway
    100469856 (KITLG)
   04015 Rap1 signaling pathway
    100469856 (KITLG)
   04072 Phospholipase D signaling pathway
    100469856 (KITLG)
   04151 PI3K-Akt signaling pathway
    100469856 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100469856 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100469856 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100469856 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100469856 (KITLG)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100469856 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 100469856
NCBI-ProteinID: XP_019657804
Ensembl: ENSAMEG00000002326
LinkDB
Position
15
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICRNRVTDDVKDVTKLVANLPKDYKIALKYVPG
MDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSPKSPELRHFTPEEFFRIFNRSIDALKDLETVASKSSECVVSSTLGPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNPIGDSNLQWAAMALPAFFSLVIGFAFGALYWKK
KQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactactcctatttaat
cctctggtcaaaactaaagggatctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagatagccctcaaatatgtccccggg
atggatgttttgcctagtcattgttggataagcgtgatggtggaacagttgtcagtcagc
ttaactgatcttctggacaaattttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtggatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcacctaaaagcccagaactcaggcattttacccctgaagaattc
ttcagaatttttaatagatccattgatgccctcaaggacttggagacggtggcatctaaa
agtagtgaatgtgtggtctcttcaacattaggtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaaccccattggagactccaacttacaatgggcagccatggca
ttgccagctttcttctctcttgtaattgggtttgcttttggagccttatactggaagaag
aaacaaccaaatctcacaaggacagttgaaaatatacagattaatgaagaggataatgaa
ataagtatgttgcaagaaaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system