KEGG   Ailuropoda melanoleuca (giant panda): 100469861
Entry
100469861         CDS       T01329                                 

Gene name
NPPA
Definition
(RefSeq) natriuretic peptides A
  KO
K12334  natriuretic peptide A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04066  HIF-1 signaling pathway
aml04270  Vascular smooth muscle contraction
aml04714  Thermogenesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04924  Renin secretion
aml04925  Aldosterone synthesis and secretion
aml05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100469861 (NPPA)
   04024 cAMP signaling pathway
    100469861 (NPPA)
   04022 cGMP-PKG signaling pathway
    100469861 (NPPA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100469861 (NPPA)
   04921 Oxytocin signaling pathway
    100469861 (NPPA)
   04924 Renin secretion
    100469861 (NPPA)
   04925 Aldosterone synthesis and secretion
    100469861 (NPPA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100469861 (NPPA)
  09159 Environmental adaptation
   04714 Thermogenesis
    100469861 (NPPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    100469861 (NPPA)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 100469861
NCBI-ProteinID: XP_002922802
Ensembl: ENSAMEG00000009870
LinkDB
Position
11
AA seq 152 aa
MDSPTITASFLLFLAFQLLGQTGANPAYGSVSNADLMDFKNLLDHLEDKMPLEDEVVPPQ
VLSEQNEEAGVALSPLPEVPPWTGEVNPAQRDGGALGRGPWDASDRSALLKSKLRALLAA
PRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR
NT seq 459 nt   +upstreamnt  +downstreamnt
atggactcccccaccatcaccgcaagcttcctcctcttcctggcatttcaactcctgggg
caaacgggagctaaccctgcatatggctctgtgtccaacgcagacctgatggatttcaag
aatttgctggaccacttggaggacaaaatgcctttagaagatgaggtcgtgccgccacaa
gtactaagtgagcagaatgaggaagctggggtggctctcagccccctccctgaggtgcct
ccctggacgggggaggtcaacccagcccagagagatgggggtgcccttgggcggggcccc
tgggatgcctccgatagatctgccctcctgaaaagcaagctgagggcactgcttgctgcc
cctcggagcctgcggaggtccagctgcttcggaggcaggatggacaggattggagcccag
agtggactgggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system