KEGG   Ailuropoda melanoleuca (giant panda): 100469915Help
Entry
100469915         CDS       T01329                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04630  Jak-STAT signaling pathway
aml04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100469915 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100469915 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100469915 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100469915 (THPO)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  CSF and other factors
   100469915 (THPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 100469915
NCBI-ProteinID: XP_011218621
Ensembl: ENSAMEG00000016994
LinkDB All DBs
Position
Un
AA seq 320 aa AA seqDB search
MELTELLLVVMLLTARLDLCLPAPPACDPRLLNKLLRDSHVLHSRLSQCPDVNPLSTPVL
LPAVDFSLGEWKTQKEQTKAQDVLGATALLLEGVMAARGQLGPTCLSSLLGQLSGQVRLL
LGALQGLLGTQGRTTTHKDPDAIFLTFQQLLRGKVRFLLLVIGPTLCAKQALPTTAVPSN
TSLLLTLHKLPNRTFGLLETNSNVSARTTGSGLLKRLHGFRAKIPGLLNQTSRSLDQTPG
PLNRTHGPLTGTHGLFPGPSPTALGAPDIPLGASDMDSLPPDLWPGYSPSPTHPPIGQYT
LFSPSPTSPTPPEPAPTSIS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagctgactgaactgctcctcgtggtcatgcttctaactgcaagactggatctgtgt
ctcccggctcctcctgcctgtgacccccgtctcctaaataaactgcttcgtgactcccat
gtccttcacagcagactgagccagtgtccagacgttaaccctttgtccacacctgtcctg
ctgcctgctgtggactttagcttgggagaatggaaaacccagaaggagcagaccaaggca
caggatgttctgggagccacggcccttctgctggaaggagtaatggcagcccggggacaa
ctgggacccacttgcctctcatccctcctgggacagctttctggacaggtccgcctcctc
cttggggccctgcagggcctcctgggaacccagggcaggaccacaactcacaaggacccc
gacgccatcttcctgaccttccagcaactgctccggggaaaggtgcgcttcctgctgctt
gtcatagggcccaccctctgtgccaagcaggccctccccacgacagctgtcccaagcaat
acctctctactcctcacactgcacaagctcccaaacaggacttttggattgttggagaca
aactccaatgtctcagccagaactactggctctggacttctgaagaggctgcacggattc
agagccaagattcctggtctgctgaaccaaacctccaggtccctagaccaaacgcctgga
cccctgaacaggacacacggacccttgactggaacccatggactctttcctggaccctca
cccacagccctaggagccccagacattcctctgggagcttcagacatggactccctgccc
cccgacctctggcctggatattctccttccccaacccatcctcctattgggcaatacaca
ctcttctctccttcacccacctcgcccacccccccggagccagctccaacctccatctcc
tga

DBGET integrated database retrieval system