KEGG   Ailuropoda melanoleuca (giant panda): 100469922
Entry
100469922         CDS       T01329                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01524  Platinum drug resistance
aml04014  Ras signaling pathway
aml04064  NF-kappa B signaling pathway
aml04115  p53 signaling pathway
aml04137  Mitophagy - animal
aml04140  Autophagy - animal
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04621  NOD-like receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml05012  Parkinson disease
aml05014  Amyotrophic lateral sclerosis
aml05022  Pathways of neurodegeneration - multiple diseases
aml05145  Toxoplasmosis
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05168  Herpes simplex virus 1 infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05212  Pancreatic cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100469922 (BCL2L1)
   04630 JAK-STAT signaling pathway
    100469922 (BCL2L1)
   04064 NF-kappa B signaling pathway
    100469922 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    100469922 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100469922 (BCL2L1)
   04137 Mitophagy - animal
    100469922 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    100469922 (BCL2L1)
   04215 Apoptosis - multiple species
    100469922 (BCL2L1)
   04115 p53 signaling pathway
    100469922 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100469922 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100469922 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    100469922 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100469922 (BCL2L1)
   05225 Hepatocellular carcinoma
    100469922 (BCL2L1)
   05220 Chronic myeloid leukemia
    100469922 (BCL2L1)
   05222 Small cell lung cancer
    100469922 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100469922 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    100469922 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    100469922 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100469922 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    100469922 (BCL2L1)
   05162 Measles
    100469922 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    100469922 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100469922 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100469922 (BCL2L1)
   01524 Platinum drug resistance
    100469922 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100469922 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100469922 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aml02000]
    100469922 (BCL2L1)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100469922 (BCL2L1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100469922 (BCL2L1)
Transporters [BR:aml02000]
 Other transporters
  Pores ion channels [TC:1]
   100469922 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100469922
NCBI-ProteinID: XP_011222034
Ensembl: ENSAMEG00000013710
UniProt: D2H915
LinkDB
Position
13
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagaggtggagacccccagtgccatcaatggcaacccatcctggcacttggcg
gacagccctgcggtgaatggagccaccggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcagtgaagcaagcgctgagggaggctggggatgagttcgaactgagg
taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcgtat
cagagcttcgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcattgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct
tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagcg
gctgaaagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcgctcttcagtcgcaaatga

DBGET integrated database retrieval system