KEGG   Ailuropoda melanoleuca (giant panda): 100470042Help
Entry
100470042         CDS       T01329                                 

Gene name
TUFM
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Translation factors [BR:aml03012]
 Eukaryotic Type
  Elongation factors
   100470042 (TUFM)
 Prokaryotic Type
   100470042 (TUFM)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    100470042 (TUFM)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100470042 (TUFM)
  Exosomal proteins of breast cancer cells
   100470042 (TUFM)
  Exosomal proteins of colorectal cancer cells
   100470042 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 100470042
NCBI-ProteinID: XP_019663593
Ensembl: ENSAMEG00000015551
LinkDB All DBs
Position
Un
AA seq 452 aa AA seqDB search
MAATTLLRATPLLSGEGAGPTPLLQGLLRPLKAPALPRLCRGLAVEAKKTYVRDKPHVNV
GTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAAR
HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYV
NKADAVQDAEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLL
DAVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGHSKHIR
SVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQPHQKVEAQVYILS
KEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKITLILRQPMILEKGQ
RFTLRDGNRTIGTGLVTETPAMTEEDKNIKWS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccaccctgctgcgcgcgacgcccctcttgagcggtgagggggccggcccg
accccattgctgcagggtctgctgcggccactgaaggccccggcactgccccgcttgtgc
cgcggcctggccgtggaggccaagaagacctatgtgcgcgacaagccccatgtgaacgtg
ggcaccatcggccatgtggaccacggcaagaccacactgaccgcggccatcacgaagatt
ttagcggaggggggtggagccaagtttaagaagtatgaagagattgacaacgcccctgaa
gagcgagcgcgtggaatcacaattaatgcggctcacgtggagtatagcactgccgcccgc
cactatgcccacacagactgccccggtcacgcagattacgtgaagaatatgatcacaggc
actgcccccctcgacggctgcatcctcgtggtggcagccaatgacggccctatgccccag
acccgagagcatctattactggccaaacagataggagtagagcacgttgtggtgtacgtg
aacaaagcagatgctgtccaggacgccgagatggtggagttggttgagctggagatccgg
gaactgctcactgagtttggctacaaaggggaggagaccccggtcatcgtaggctctgcc
ctctgtgcccttgagcaacgtgaccctgagctaggcgtgaagtccgtgcagaagctgctg
gatgccgtggacacttacatcccagtacccacccgagacctggagaagcctttcctgctg
cctgtagagtccgtttactctattcctggccgtggcacggtggtgacaggtacattagag
cgtggcattttgaagaagggagacgagtgtgagttcctgggacatagcaagcacattcgc
agtgtggtgacaggcattgagatgttccacaagagtctggagcgggcagaggcaggtgac
aaccttggagccctggtccgaggcttgaagcgagaggacctgaggcgtggcctggtcatg
gccaagccagggtccatccagcctcatcagaaggtggaggcacaggtttatatcctcagc
aaggaggagggtggccgccacaagccttttgtgtcccacttcatgcctgtcatgttctcc
ctgacttgggacatggcctgtcgtgtcatcttaccaccagggaaggagcttgctatgcct
ggggaggacctgaagatcacccttatcttgcggcagcccatgatcttagaaaaaggccag
cgtttcacccttcgagacggcaaccggaccattggcactggccttgtcactgagacaccg
gccatgactgaggaagacaagaacatcaagtggagttga

DBGET integrated database retrieval system