KEGG   Ailuropoda melanoleuca (giant panda): 100470060
Entry
100470060         CDS       T01329                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00220  Arginine biosynthesis
aml00330  Arginine and proline metabolism
aml01100  Metabolic pathways
aml04020  Calcium signaling pathway
aml04066  HIF-1 signaling pathway
aml04146  Peroxisome
aml04371  Apelin signaling pathway
aml04926  Relaxin signaling pathway
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05022  Pathways of neurodegeneration - multiple diseases
aml05133  Pertussis
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05200  Pathways in cancer
aml05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100470060 (NOS2)
   00330 Arginine and proline metabolism
    100470060 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100470060 (NOS2)
   04066 HIF-1 signaling pathway
    100470060 (NOS2)
   04020 Calcium signaling pathway
    100470060 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100470060 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100470060 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470060 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100470060 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100470060 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100470060 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    100470060 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100470060 (NOS2)
   05152 Tuberculosis
    100470060 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100470060 (NOS2)
   05145 Toxoplasmosis
    100470060 (NOS2)
   05140 Leishmaniasis
    100470060 (NOS2)
   05142 Chagas disease
    100470060 (NOS2)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100470060 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 100470060
NCBI-ProteinID: XP_034497738
Ensembl: ENSAMEG00000005154
LinkDB
Position
13
AA seq 1128 aa
MLAVSFYSLVTQDDPKCHSLGKHRNESPQSLTGTVKTSPESLIKLDAPPSACPRHVRIKN
WGSGMIFQDTLHHKAKGDLACKSKSCLGAIMNSKSLTRGPRDKPTPPDELLPQAIEFVNQ
YYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCIGRIQWSNL
QVFDARSCSTAKEMFEHICRHLRYATNNGNIRSAITVFPQRSDGKHDFRVWNAQLIRYAG
YQMPDGTILGDPASVEFTQLCIDLGWKPKYGRFDVVPLVLQADGQDPEFFEIPPDLVLEV
PMEHPKYEWFRELQLKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRY
NILEEVGRRMGLETHNLASLWKDRAVIEINVAVLHSFQKQNVSIMDHHSAAESFMKHMQK
EYRSRGGCPADWIWLVPPISGSITPVFHQEMLNYVLSPFYYYQVEAWKTHTWQDEKRRPR
RRKIPFKVLVKAVLFSSMLMHKTMASRVRATILFATETGKSETLARDLGALFSCAFNPKV
LCMDKYRLRHLEDEQLLLVVTSTFGNGDSPGNGEKLKKSLFMLKELTNKFRYAVFGLGSS
MYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELSGQEEAFHSWAVQTFKAACETFEVRGK
HHIQIPRLYTCNVTWDPQHYRLVQGSQPLDLERALSSMHSKKVITLRLKSQRNLQSPQSS
RTTLLVELSCEDSRGLSYLPGEHLGVCPSNQLALVQGILERVVDGPSPHQPVHLEILSEN
GSYWVRDKRLPPCSLSQALTYFLDITTPPTPLLLRKLAQLATEEAERQRLETLCQPSEYN
KWKFTSSPTFLEVLEEFPSLRVSAGFLLSQLPILKPRYYSISSSRDRTPTEVHLTVAVLT
YRTRDGQGPLHHGVCSTWLSSLKPQDPVPCFVRSAGNFQLPEDPSHPCILIGPGTGIAPF
RGFWQQRLHDTKYKGLQAGRMTLVFGCRRPDEDHLYREEMLEMAQNGVLHEVHTAYSRLP
GQPKVYVQDILRQRLASEVLRVLHEEHGHLYVCGDVRMARDVAHTLKLLVAAKLSLSEEQ
VEDYFFQLKSQKRYHEDIFGAVFPYEVKKDGAARQPGDPKVTTAYGRS
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgctggctgtttccttttacagtctagtgacacaggatgaccccaagtgtcacagcctc
ggcaagcaccggaatgagtccccccagtccctcacggggacagtaaagacgtctccagaa
tccctgatcaagctggatgcacccccatcggcctgcccgcggcatgtgaggatcaaaaac
tggggcagtgggatgatcttccaagacacacttcaccataaggccaaaggggatctcgct
tgcaagtccaagtcttgtctgggagccatcatgaactccaaaagtttgaccagaggaccc
agggacaagcctacccccccagacgagcttctgcctcaagctattgaatttgtcaaccaa
tattatggttccttcaaagaggcaaaaatagaggaacatctggccagggtggaagcggta
acaaaggagatagaaacaacaggaacctatcagctgacgggggatgagctcatcttcgcc
accaagcaggcctggcgcaacgctccccgctgcatcggaagaatccagtggtccaacctt
caggtcttcgacgcccggagctgttccactgccaaggaaatgttcgagcacatctgcaga
cacctgcggtatgccaccaacaacggcaacatcagatcggccatcaccgtgttcccccag
cggagcgatgggaagcatgacttccgggtctggaacgctcagctcattcggtatgccggc
taccagatgcctgacggcaccatcctgggggaccccgccagcgtggagttcacccagctg
tgcatcgacctgggctggaagcccaagtacggtcgcttcgatgtggtgcccctggtgctg
caggcggatggccaagacccggagttctttgaaatcccacctgaccttgtgctcgaggtg
cccatggaacatcccaagtacgagtggttccgtgagctccagctgaagtggtacgccctg
cccgcagtggccaacatgctgcttgaggtgggcggcctcgagttcccggggtgccccttc
aacggctggtacatgggcacggagatcggggtccgggacttctgtgacgttcagcgttac
aacattctggaggaagtgggcagaaggatgggcctggaaacgcacaatctggcctcactc
tggaaggaccgggctgtcattgagatcaatgtcgctgtgcttcacagtttccagaagcag
aatgtgagcatcatggaccaccactcagccgcagagtcattcatgaagcacatgcagaag
gagtaccgctcccgcgggggctgcccggccgactggatttggctggtccccccgatttct
gggagcatcactcctgtgttccaccaggagatgttaaactatgtgctgtcccctttctac
tactaccaggtggaagcctggaaaacccacacctggcaggatgagaagcggagaccccgg
agaagaaagattccattcaaagtcttggtgaaagctgtgctcttctcctccatgctgatg
cacaagaccatggcttcccgagtcagagccacaatcctctttgcgacggagacaggaaag
tcagaaacgctggcccgggacctgggggccttgttcagctgcgccttcaaccccaaggtt
ctctgcatggacaagtataggctgcgccatctggaggacgagcagctgctcctggtggtg
accagcacgtttgggaatggagactcccccggcaacggagagaaactgaaaaaatctctc
ttcatgctgaaagagcttaccaacaagttcaggtatgctgtgttcggcctcggctccagc
atgtaccctcagttctgtgcctttgctcatgacatcgaccagaagctctcccatctgggg
gcctctcagctcgccccaacaggggaaggggacgagctcagtggacaggaggaagccttc
cacagctgggccgtgcaaaccttcaaggcggcctgtgagacgttcgaggtgcgaggcaaa
caccacattcagatccccaggctctacacctgcaacgtgacatgggacccacagcactac
aggctcgtgcagggctcgcagcctctggacctcgagagagccctcagcagtatgcactcc
aagaaggtgatcaccctgaggctcaagtcacagcggaatctgcagagtccccagtccagc
cgcaccaccctcctggtggagctctcctgtgaggacagccgcgggctgagctacctgccc
ggagagcacctcggggtttgccccagtaaccagctggccctggtgcaaggcatcttggaa
agagtggtagacggcccctcaccccaccagcctgtgcacctggagatcctcagtgagaac
ggaagctactgggtcagagataagcggctgcccccgtgctcactcagccaggccctcacc
tacttcctggacatcaccacccctccaaccccgctgctgctccgaaagctggcacagctg
gccacggaagaggccgagaggcagaggctagagaccctgtgccagccctcagaatacaac
aagtggaagttcaccagcagccccacattcctggaggtgctggaggagttcccgtccctg
cgggtgtctgctggcttcctgctctcccagctccctattctgaaaccccggtactactcc
atcagctcctccagggaccgcacacccacggaggtgcacctcacggtggccgtgctcacg
taccgcacccgagatggccaaggtcccttgcaccacggtgtctgtagcacgtggctcagt
agcctgaagccccaagacccagtaccctgcttcgtgagaagtgccggcaacttccagctc
cctgaggacccctcccatccttgcatcctcatcggacctggcacaggcattgcccccttc
cgcggtttctggcagcagcggctccatgacaccaagtacaaagggctccaggccggccgc
atgaccctggtgttcgggtgccgccgcccagatgaggaccacctgtatcgggaggagatg
ctggagatggcccagaatggggtgctgcatgaggtgcacacagcctactctcgcctgcct
ggccagcccaaggtctatgttcaagacatcctgcggcagcggctggccagcgaggtgctc
cgcgtgctccacgaggagcacggccacctttatgtttgtggggatgtgcgtatggcccgg
gatgtggcccataccctgaagctcctggtggctgccaagctgagcctgagcgaggagcag
gtggaggactactttttccagcttaagagccagaagcgctatcatgaagatatctttggt
gctgtgtttccctacgaggtgaaaaaagatggggcagcgaggcagcccggcgatcccaaa
gttacaacagcctacgggagaagttaa

DBGET integrated database retrieval system