KEGG   Ailuropoda melanoleuca (giant panda): 100470600
Entry
100470600         CDS       T01329                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04064  NF-kappa B signaling pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100470600 (GADD45G)
   04064 NF-kappa B signaling pathway
    100470600 (GADD45G)
   04068 FoxO signaling pathway
    100470600 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100470600 (GADD45G)
   04210 Apoptosis
    100470600 (GADD45G)
   04115 p53 signaling pathway
    100470600 (GADD45G)
   04218 Cellular senescence
    100470600 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470600 (GADD45G)
   05202 Transcriptional misregulation in cancer
    100470600 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100470600 (GADD45G)
   05212 Pancreatic cancer
    100470600 (GADD45G)
   05225 Hepatocellular carcinoma
    100470600 (GADD45G)
   05226 Gastric cancer
    100470600 (GADD45G)
   05214 Glioma
    100470600 (GADD45G)
   05216 Thyroid cancer
    100470600 (GADD45G)
   05220 Chronic myeloid leukemia
    100470600 (GADD45G)
   05217 Basal cell carcinoma
    100470600 (GADD45G)
   05218 Melanoma
    100470600 (GADD45G)
   05213 Endometrial cancer
    100470600 (GADD45G)
   05224 Breast cancer
    100470600 (GADD45G)
   05222 Small cell lung cancer
    100470600 (GADD45G)
   05223 Non-small cell lung cancer
    100470600 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100470600 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100470600 (GADD45G)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100470600 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100470600 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100470600
NCBI-ProteinID: XP_034503057
LinkDB
Position
17
AA seq 159 aa
MTLEEIRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADAEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEAAAPGDLHCI
LISNPNEDAWKDPALEKLSVFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaggaaatccgcggccaagatacggttcccgaaagcaccgccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctgtcggcgcagcgccagggctgcctcacc
gccggcgtctatgagtccgccaaagtcttgaatgtggaccccgacaacgtgaccttctgc
gtgctggcggccgacgcggaggacgagggcgacatcgcgctgcagatccactttacgctg
atccaggcgttctgctgtgagaacgacatagacatcgtgcgcgtgggcgacgtgcagcgg
ctggcggcgatagtgggcgccggcgacgaggctgcagcgccgggagacctgcactgtatc
ctcatttcgaaccccaatgaggacgcgtggaaggaccccgccttggagaagctcagcgtg
ttctgcgaagagagccgcagcgtcaacgactgggtgcccagtatcaccctccccgagtga

KEGG   Ailuropoda melanoleuca (giant panda): 100477654
Entry
100477654         CDS       T01329                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04064  NF-kappa B signaling pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100477654 (GADD45A)
   04064 NF-kappa B signaling pathway
    100477654 (GADD45A)
   04068 FoxO signaling pathway
    100477654 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100477654 (GADD45A)
   04210 Apoptosis
    100477654 (GADD45A)
   04115 p53 signaling pathway
    100477654 (GADD45A)
   04218 Cellular senescence
    100477654 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477654 (GADD45A)
   05202 Transcriptional misregulation in cancer
    100477654 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100477654 (GADD45A)
   05212 Pancreatic cancer
    100477654 (GADD45A)
   05225 Hepatocellular carcinoma
    100477654 (GADD45A)
   05226 Gastric cancer
    100477654 (GADD45A)
   05214 Glioma
    100477654 (GADD45A)
   05216 Thyroid cancer
    100477654 (GADD45A)
   05220 Chronic myeloid leukemia
    100477654 (GADD45A)
   05217 Basal cell carcinoma
    100477654 (GADD45A)
   05218 Melanoma
    100477654 (GADD45A)
   05213 Endometrial cancer
    100477654 (GADD45A)
   05224 Breast cancer
    100477654 (GADD45A)
   05222 Small cell lung cancer
    100477654 (GADD45A)
   05223 Non-small cell lung cancer
    100477654 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100477654 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100477654 (GADD45A)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100477654 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100477654 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100477654
NCBI-ProteinID: XP_002921989
Ensembl: ENSAMEG00000004529
UniProt: G1LCY5
LinkDB
Position
2
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLEPDASPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaagaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctcgaggaagtgctcagcaaagccctgagtcagcgcaccatcaccgtcggggtg
tatgaggcggccaagctgctcaacgtcgacccagataacgtggtgctgtgtctgctggcg
gcggacgaggacgacgacagggatgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccgactggccgag
ctcctgctcctggagccggacgccagcccagcagcgagcgagggcgccgagcagcccccg
gacctgcactgcgtcctggtgacgaatccacattcatcacagtggaaggatcctgcctta
agtcagcttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

KEGG   Ailuropoda melanoleuca (giant panda): 100482871
Entry
100482871         CDS       T01329                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04064  NF-kappa B signaling pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04210  Apoptosis
aml04218  Cellular senescence
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100482871 (GADD45B)
   04064 NF-kappa B signaling pathway
    100482871 (GADD45B)
   04068 FoxO signaling pathway
    100482871 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100482871 (GADD45B)
   04210 Apoptosis
    100482871 (GADD45B)
   04115 p53 signaling pathway
    100482871 (GADD45B)
   04218 Cellular senescence
    100482871 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482871 (GADD45B)
   05202 Transcriptional misregulation in cancer
    100482871 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100482871 (GADD45B)
   05212 Pancreatic cancer
    100482871 (GADD45B)
   05225 Hepatocellular carcinoma
    100482871 (GADD45B)
   05226 Gastric cancer
    100482871 (GADD45B)
   05214 Glioma
    100482871 (GADD45B)
   05216 Thyroid cancer
    100482871 (GADD45B)
   05220 Chronic myeloid leukemia
    100482871 (GADD45B)
   05217 Basal cell carcinoma
    100482871 (GADD45B)
   05218 Melanoma
    100482871 (GADD45B)
   05213 Endometrial cancer
    100482871 (GADD45B)
   05224 Breast cancer
    100482871 (GADD45B)
   05222 Small cell lung cancer
    100482871 (GADD45B)
   05223 Non-small cell lung cancer
    100482871 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100482871 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100482871 (GADD45B)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100482871 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100482871 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100482871
NCBI-ProteinID: XP_002925944
Ensembl: ENSAMEG00000005608
LinkDB
Position
Unknown
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEPRDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgttggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagaccgtgagc
gccgcggtggaggagctgttggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgaatcagccaagttgatgaatgtggaccctgacagcgtggtcctgtgccttctggcc
attgatgaggaagaggaggatgacatcgccctgcagatccacttcacactcatccagtcc
ttttgctgtgacaatgacattaatatcgtccgggtgtcaggcatgcagcgtctggcccag
ctgctgggcgagccagcggagacccagggcaccaccgagccccgagacctgcactgcctc
ctggttacgaatcctcacacagatgcctggaaaagccacggcctcgtggaggtagccagt
tactgcgaagagagccgagggaacaaccagtgggtcccctacatctccctccaggagcgc
tga

DBGET integrated database retrieval system