KEGG   Ailuropoda melanoleuca (giant panda): 100470609
Entry
100470609         CDS       T01329                                 

Gene name
WDR62
Definition
(RefSeq) WD repeat-containing protein 62 isoform X1
  KO
K21762  WD repeat-containing protein 62
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100470609 (WDR62)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100470609 (WDR62)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A DUF5046
Other DBs
NCBI-GeneID: 100470609
NCBI-ProteinID: XP_002920943
Ensembl: ENSAMEG00000000953
LinkDB
Position
12
AA seq 1538 aa
MAALGPGGYARNDAVEKLPSVTVGVPARRGQCSPPPAPPLCLRRRTRLSAASEDTVQNRV
SLEKVLGITAQNSSGLTCDPSTGHVAYLAGCVVVILNPKENKQQHIFNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVDEKSQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDVVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTEAKVTGTVPL
IGRSGILGELHNNIFCGVACGRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFQAHSLQYLANLPKPHYLGVDVAQGLEPSFLFCRKAEAVYP
DTVALTFDPIHQWLSCVYKDHSIYIWDVKDINKVGKMWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRIWNMDSSPDSHWQKNIFSNTLLKVVYVENDIQHLQNMSHFPD
RGSENGTPMDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCG
ADKSIYFRSAQRTLDGLRFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVSG
KQRKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECVAKMFGHSEIVTG
MKFTYDCRHLITVSGDSCVFIWHLGPEITNCMKQHLLEINHQEQQQQQNVKDGMWSNQPR
QESYTSVPSEICSLSPGEQTEDELEEECEPEELLKTPSKESLDPDPRCLLTNGKLPLWAK
RLLGDEDVADGSAFHAKRSYKPHGRWAERADQEPLKTILDARDLDCYFTPMKPESLEDSI
LDTVEPQSLAALLSEPESPQEVGCGHPSFLPLQRESSEDTELIIYSLEAELMVTGTDSEY
CTKDVKGELRDQQGDSYLRVSSIGPKDQSPPEDSGESEADLECSFTTTHSPPPRPAPDPR
FDMMMPHMPGCPGTTEELPQPEVPGISDGSLPQTPEQEKFLRHHFETLTDAHPEELFHGA
LRDLEASESEDFFNPRLSISAQFLSRLQKTSRFTHSFPPRLPLHLVKSPEVKFTELGGSQ
SRAEPLSASAGYTSPGRPSVLAGRKAEEAQESLEAWRPLTPCLPGLAPRAPSSSVLPIDG
KPPTPTALPTPGLAQGVHGPSTHPYMEATASSRAKMPRSISLEDSEGPVLAELTRPLHRP
SSVGELASLGQELQAIPTTAAPSSNSEGQEPALSSWGNHEARASLKLTLSSICDRLLLPP
PPLEPSATQPSVTVTTATFPVPSPMDASSPRLHNSTFLPRLLVPEPLNTPAHPISTPLPE
ARAGVPGSITSLLEPTPDALSLVQGSPGHWEEPGVPARVLPPAPLELSSVSTIVHRLQTA
FQEALDLYHLVVSSDQVSTEQQRQARTELASTFLWIHNQLEANDWLVGTDVAPAQAQHSL
GSPSPTTLCPLASPDLHALLEHYSELLVQAVRRKARGD
NT seq 4617 nt   +upstreamnt  +downstreamnt
atggcggccttgggtcccggaggctacgcgcggaacgatgctgtcgagaagctgccatcc
gtcacggtgggagttccggcgcggaggggccagtgctctcctccccccgctccgccgctc
tgtcttcggcggcggacacgactttcggcggcgtcggaggacacggtgcagaaccgggtg
tcactcgagaaggtacttggcatcacagcccagaacagcagtggcctaacctgtgacccc
agtacaggccacgtggcctacctagcaggctgtgtggtggtgattttgaatcccaaggag
aacaagcagcagcatatttttaacactgccaggaagtctctgagtgctctggccttctct
cctgatgggaagtacatagtgacgggggagaacgggcataggcctgctgtacgcatctgg
gatgtggatgagaagagtcaggtggcagagatgctgggccacaagtatggcgtggcctgt
gtggccttctcccccaatatgaagcacattgtgtccatgggctaccagcacgacatggta
ctcaacgtctgggactggaagaaagacgttgtggtggcttccaacaaggtatcgtgcagg
gtcattgccctctccttctctgaggacagcagctattttgtcaccgtagggaatcggcac
gtgaggttctggttcttggaagtctccacggaagcaaaggtgacgggcacagtgcccctc
atcgggcgctcaggcatcctgggtgagctgcacaacaacatcttctgtggtgtggcctgc
ggccggggccggatggccggcagtaccttctgtgtgtcctactcgggcctcctttgccag
ttcaacgagaagagggtgctggagaagtggatcaacctgaaggtctccttatcttcctgc
ctctgtgtcagccaggagctcatcttctgcggctgcacagatgggatagtccgcatcttc
caggcccacagcttgcaatacctcgcgaacctgcccaaaccacactaccttggggtggat
gtggcccagggcctggagcccagcttcctcttctgcaggaaggcagaagcagtctaccca
gatacagtggcactcaccttcgaccccatccatcagtggctgtcttgtgtgtataaggac
cacagcatctacatctgggatgtcaaagacatcaacaaagtaggcaagatgtggtcggag
ctcttccacagctcctacgtctggaacgtggaggtgtatcctgagtttgaagatcagaga
gcttgcctgccatcaggatcttttcttacttgttcctcagacaacaccatccgcatttgg
aacatggatagcagccctgactctcactggcagaaaaatatcttcagtaacaccctgctg
aaggtcgtgtatgtagagaatgacatccagcacctgcagaacatgtcccacttcccagac
cgggggagtgaaaatgggacccctatggacgtgaaggctggggtgcgagtcatgcaggtc
agtcctgatggccagcacttggcttccggagaccgaagtggaaatctgaggatccacgag
ctgcacttcatggatgagctggtcaaggtggaggcccatgatgccgaggtgctgtgcctg
gagtactccaagcctgagacagggctgaccttgttggcctcggccagtagggaccgactg
atccacgtgctgaacgttgagaagaactacaacctggagcagaccctggacgaccactcc
tcctccatcacggccatcaagttcgctggcaacagagacatccagatgatcagctgtggg
gctgacaagagcatctactttcgcagtgcccagcggaccttggatggactacgctttgtc
cgtacccaccacgtggcagagaagaccaccttgtacgacatggacattgatatcacccaa
aagtatgtggccgtggcctgccaggaccgcaatgtgagagtctacaacaccgtgagtggg
aagcagaggaagtgctacaagggctcccagggggacgaagggtccctgctgaaggtccac
gtggacccctcaggcaccttcctggccactagctgctccgacaaaagcatctcagtgatt
gacttttactcgggcgagtgcgttgccaagatgtttggtcactcagaaatcgttaccggc
atgaagttcacctacgactgtcgtcacttgatcacggtatccggagacagctgcgtgttc
atctggcacctgggcccggaaatcactaactgcatgaagcagcacttgctggagatcaac
caccaggagcagcagcagcagcagaacgtgaaggatgggatgtggagcaaccagcccagg
caggagagctatacatctgtgcccagcgagatatgctccttaagccctggagagcagaca
gaggatgagctggaggaagagtgtgaaccggaagagttgctgaagacaccatccaaagag
agcttggacccagatcctcgatgtctgctgaccaatggcaaactgccactctgggcaaag
cggctgctaggagacgaagatgtggcagatggctcagccttccacgctaagcgcagctac
aagccacatggccgctgggcagagcgggctgaccaggagcccctcaagaccatcctggat
gcccgggacctggattgctacttcacccccatgaagcccgagagcctggaggactctatt
ctggatacagtggagccccagagcctggcggccctgctgagtgagccggagagtccccag
gaggttggctgtgggcatccctccttcctgcccctgcagagggagtcctctgaggacacc
gagctcatcatctactccctggaggcagagttgatggtcacagggacagacagtgagtac
tgcacgaaggacgtcaagggggagctcagagaccagcaaggtgactcctacctcagagtc
tcttccatcggcccaaaggatcagagcccacctgaggactcgggggagtcagaggccgac
ttggagtgcagcttcaccaccacccactctccccctccacggccagccccggaccctcgg
tttgacatgatgatgccccacatgccaggatgcccaggtaccacagaagagttaccccag
cccgaggtgccaggcatatccgacggctccctgccccagacccctgagcaggagaagttc
ctccgccaccacttcgagacgcttactgacgctcaccccgaggagctcttccatggagcc
ctgagagacttggaggcgtctgagtctgaggacttctttaatccccggctgagcatttca
gcccagttcctctcacgcctccagaagacatccaggttcacccacagcttccctcctcgg
ctgcccctacacctggtgaagtctccagaggtcaaattcacagagcttgggggcagccag
tccagagcagagcctctgagtgcaagcgctggctacacctccccaggcaggcccagcgtc
ctcgctgggagaaaggctgaggaggcccaggagagcctggaggcctggcgcccactgacc
ccctgcctcccaggcctggcgccccgtgccccctcctcctcagtgctgcccattgacggg
aagcctccgacacccacagccctacccactccaggcctggctcagggtgtccacggcccc
tccacacacccctacatggaggccactgccagctcccgtgccaagatgccacgcagcatc
tccctcgaggacagtgaaggccctgtgctggctgagctgaccaggcccctccacaggccc
tcctccgtgggggagctggcatccctgggccaggagctccaggccatccccaccactgca
gcacccagttctaacagcgagggccaagaacctgccttgtcctcctggggcaaccatgag
gcccgggccagcctgaagctgaccctgtcgagcatctgtgacaggctcttgctaccccct
cccccactggaaccttcggccacccaacccagtgtcactgtcacaacagccaccttccca
gtccccagtcccatggatgcaagctccccgaggctccacaattccacctttctcccaagg
ctcctggtccctgagcccctcaacacccctgcccaccccatcagcaccccacttccagag
gccagggctggggtccctggcagcatcacctccctcctggagcccacccctgatgcactc
agtctggtccagggcagccctggacactgggaggagcctggggtgccagccagggtcctg
cccccagctcctcttgaactgagcagtgtgagcaccatcgtgcacagactgcagactgcc
ttccaagaagccctggacctttaccacctggtggtctccagtgaccaggtgagcactgag
cagcagcggcaggcacggactgagctggcctccacctttctttggatccataaccagcta
gaggccaacgactggctggttgggactgacgtggccccggcccaggcccagcacagcctg
ggttccccctccccaactacactgtgccccctggccagccccgatttgcatgccctgctg
gaacactactcggagctgctggtgcaggccgtacggaggaaggcacggggggactga

DBGET integrated database retrieval system