KEGG   Ailuropoda melanoleuca (giant panda): 100470763
Entry
100470763         CDS       T01329                                 

Gene name
VDAC3
Definition
(RefSeq) voltage-dependent anion-selective channel protein 3 isoform X1
  KO
K15041  voltage-dependent anion channel protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04216  Ferroptosis
aml04217  Necroptosis
aml04218  Cellular senescence
aml04613  Neutrophil extracellular trap formation
aml04621  NOD-like receptor signaling pathway
aml04979  Cholesterol metabolism
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05161  Hepatitis B
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100470763 (VDAC3)
   04022 cGMP-PKG signaling pathway
    100470763 (VDAC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100470763 (VDAC3)
   04217 Necroptosis
    100470763 (VDAC3)
   04218 Cellular senescence
    100470763 (VDAC3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100470763 (VDAC3)
   04621 NOD-like receptor signaling pathway
    100470763 (VDAC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    100470763 (VDAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100470763 (VDAC3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100470763 (VDAC3)
   05012 Parkinson disease
    100470763 (VDAC3)
   05016 Huntington disease
    100470763 (VDAC3)
   05017 Spinocerebellar ataxia
    100470763 (VDAC3)
   05020 Prion disease
    100470763 (VDAC3)
   05022 Pathways of neurodegeneration - multiple diseases
    100470763 (VDAC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100470763 (VDAC3)
   05161 Hepatitis B
    100470763 (VDAC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aml03029]
    100470763 (VDAC3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aml04040]
    100470763 (VDAC3)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    100470763 (VDAC3)
Ion channels [BR:aml04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   100470763 (VDAC3)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 100470763
NCBI-ProteinID: XP_019654264
Ensembl: ENSAMEG00000005095
LinkDB
Position
18
AA seq 284 aa
MCNTPTYCDLGKAAKDIFNKGYGFGMVKIDLRTKSCSGVMEFSTSGHAYTDTGKASGNLE
TKYKVCNYGLTFTQKWNTDNTLGTEISLENKLAEGLKLTLDTIFVPNTGKKSGKLKASYK
RDCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQ
LHTHVNDGTEFGGSIYQKVNEKMETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNN
ASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA
NT seq 855 nt   +upstreamnt  +downstreamnt
atgtgtaacacaccgacttactgtgacctaggaaaggccgccaaggatatcttcaataaa
ggatatggatttggcatggtcaagatagatctgagaaccaagtcatgtagtggagtgatg
gaattttctacttctggtcatgcttacactgatacagggaaagcgtcaggaaacctagag
accaaatataaggtctgtaactatggacttaccttcacccagaagtggaacacagacaat
actcttggaacagaaatctctttggagaataagttggctgaaggattgaaactgactctt
gataccatatttgtaccgaacacaggaaagaagagtggaaaattgaaggcctcttacaaa
cgggattgtttcagtcttggcagtaatgttgatatagatttttctggaccaaccatctat
ggctgggctgtgttagcctttgaaggttggcttgctggctatcagatgagttttgacaca
gccaaatccaaactgtcacagaataatttcgccctgggttacaaggctgcagacttccag
ctgcacactcatgtgaatgatggcactgaatttggagggtctatctaccagaaggttaac
gagaagatggaaacgtcaataaaccttgcctggacggccggcagtaacaatacccgtttc
ggcatcgctgctaagtacaagctggactgtagaacttctctgtctgctaaagtaaataat
gccagcctgattggactgggttatactcagacccttcgaccaggtgtcaaactgacccta
tcagctttaatcgatggaaagaacttcaatgcaggaggtcacaaggttggattgggattt
gaactagaagcttaa

DBGET integrated database retrieval system