KEGG   Ailuropoda melanoleuca (giant panda): 100471009
Entry
100471009         CDS       T01329                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04115  p53 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04218  Cellular senescence
aml04934  Cushing syndrome
aml05161  Hepatitis B
aml05162  Measles
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05215  Prostate cancer
aml05222  Small cell lung cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100471009 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100471009 (CCNE1)
   04114 Oocyte meiosis
    100471009 (CCNE1)
   04115 p53 signaling pathway
    100471009 (CCNE1)
   04218 Cellular senescence
    100471009 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471009 (CCNE1)
   05206 MicroRNAs in cancer
    100471009 (CCNE1)
   05203 Viral carcinogenesis
    100471009 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100471009 (CCNE1)
   05215 Prostate cancer
    100471009 (CCNE1)
   05222 Small cell lung cancer
    100471009 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100471009 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100471009 (CCNE1)
   05161 Hepatitis B
    100471009 (CCNE1)
   05162 Measles
    100471009 (CCNE1)
   05169 Epstein-Barr virus infection
    100471009 (CCNE1)
   05165 Human papillomavirus infection
    100471009 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100471009 (CCNE1)
   03036 Chromosome and associated proteins [BR:aml03036]
    100471009 (CCNE1)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100471009 (CCNE1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100471009 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C CBM_1 Connexin50
Other DBs
NCBI-GeneID: 100471009
NCBI-ProteinID: XP_034493997
Ensembl: ENSAMEG00000009668
LinkDB
Position
12
AA seq 410 aa
MPRERRERDAKERDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIAKIDRTVRSQCGGQ
TWDGNSVCENPCSLIPTPDKEEGEPASPSSTCGPQSFMLSRASPLPMLNWANRDEVWKIM
LNKEKTYLRDKHLMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGEEILSMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFPYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPDEDSHNI
QTHVNSLDLLDKAQAKKAILSEQNRISPLPSGVLTPPQSSKKQSCEQGTA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagaggagggagagggatgcgaaggaacgggacaccatgaaggaggaaagt
ggcaccgatgtctctgttcgctccaggaaaaggaaggcaaatgtggctgttttcttgcag
gatccagatgaagagattgcaaaaatcgacaggactgtgagaagccagtgcggcggtcag
acttgggacggtaattctgtgtgtgaaaacccctgctccttgattcccacacctgacaaa
gaagagggcgagccggcatccccaagttccacgtgtggaccgcagagtttcatgctctcc
agagcctcaccactgcctatgctgaactgggcaaatagagatgaggtctggaaaattatg
ctaaacaaggaaaagacatacttaagggataagcacttaatgcagcggcaccctctcctg
cagcctaagatgcgagcgattcttctggattggttaatggaggtgtgcgaagtctataaa
cttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatattgtaaaaacacttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctaccctccaaagctacaccagtttgcttatgtaacggatggggct
tgttcaggagaggagattctcagcatggaattaatcattatgaaggcccttaagtggcac
ttaagtcccctgaccattgtgtcctggctgaatgtatatatgcaggttgcatatctaaat
gacttatatgaagtgctcctgccacagtatccccagcaaatcttcatacagatcgcagag
cttttagatctttgtgtcctggatgttggctgcttagaatttccctatggtgtacttgct
gcttctgccttgtatcatttctcttcctctgaattgatgcaaaaggtttcagggtatcag
tggtgcgatatagagaagtgtgtcaagtggatggttccatttgccatggttataagggag
acaggaagttcgaaactgaagcacttcaggggggttcctgatgaagactcgcacaacatc
cagacgcacgtcaacagcttggatttgctggacaaagcccaagcaaagaaagccatattg
tctgaacaaaataggatttctcctctcccctccggggtcctcactcctccacagagcagt
aagaagcagagctgtgagcaggggacagcgtga

KEGG   Ailuropoda melanoleuca (giant panda): 100483627
Entry
100483627         CDS       T01329                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04115  p53 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04218  Cellular senescence
aml04934  Cushing syndrome
aml05161  Hepatitis B
aml05162  Measles
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05215  Prostate cancer
aml05222  Small cell lung cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100483627 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100483627 (CCNE2)
   04114 Oocyte meiosis
    100483627 (CCNE2)
   04115 p53 signaling pathway
    100483627 (CCNE2)
   04218 Cellular senescence
    100483627 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100483627 (CCNE2)
   05206 MicroRNAs in cancer
    100483627 (CCNE2)
   05203 Viral carcinogenesis
    100483627 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100483627 (CCNE2)
   05215 Prostate cancer
    100483627 (CCNE2)
   05222 Small cell lung cancer
    100483627 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100483627 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100483627 (CCNE2)
   05161 Hepatitis B
    100483627 (CCNE2)
   05162 Measles
    100483627 (CCNE2)
   05169 Epstein-Barr virus infection
    100483627 (CCNE2)
   05165 Human papillomavirus infection
    100483627 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100483627 (CCNE2)
   03036 Chromosome and associated proteins [BR:aml03036]
    100483627 (CCNE2)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100483627 (CCNE2)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100483627 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100483627
NCBI-ProteinID: XP_034524217
Ensembl: ENSAMEG00000005590
LinkDB
Position
9
AA seq 404 aa
MSRRSSRLQAKQQSQPNQTDSPQEAQIIQAKKRKTAQDVKKRKEEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKDVWLNMLKK
ETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDNISECVDWMVPFVSVVKSTSPVKLKIFKKISMEDRHNIQTH
TNYLAMLDEVNYVNTFRKEGQLSPVCSGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcaacagtcccagcccaaccagacggat
tccccccaagaagcccagataattcaggccaagaagagaaaaacagctcaggatgtcaaa
aaaagaaaagaggaggtcaccaagaaacatcagtatgagattaggaattgttggccacct
gtattatctggggggatcagtccttgtattatcattgaaacaccccacaaggaaatagga
acaagtgacttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagttggggatgttcaaaggatgtttggctaaacatgctaaaaaaa
gagaccagatatgttcatgacaaacattttgaagttctgcattctgacttagaaccacag
atgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcataga
gaaacattttaccttgcgcaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcatcgcttctaaacttgag
gaaatatatgctcctaagctccaagagtttgcttatgtcactgatggtgcctgcagtgaa
gaggatatcttaagaatggaacttattatattaaaggctttaaaatgggaactctgtcct
gtaacagtcatctcctggctaaatctcttcctccaagtggatgctcttaaagatgctccg
aaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagcttttagat
ctgtgtattctagctatcgactcattagagttccagtacagaatactggctgccgctgcc
ttgtgccattttacctctattgaagtggttaagaaagcctcaggtttggaatgggacaac
atttctgaatgtgtagactggatggtgccttttgtcagtgtagtaaaaagtaccagtccc
gtgaagctgaagatttttaagaagatttctatggaagatagacacaatatccagacccat
acaaattatctggctatgctggatgaagtaaattacgtaaacaccttcagaaaagaagga
cagttgtcaccagtgtgcagtggaggcattatgacaccaccgaagagcactgaaaaacca
ccaggaaaacactaa

DBGET integrated database retrieval system