KEGG   Ailuropoda melanoleuca (giant panda): 100471095
Entry
100471095         CDS       T01329                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04071  Sphingolipid signaling pathway
aml04115  p53 signaling pathway
aml04141  Protein processing in endoplasmic reticulum
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04215  Apoptosis - multiple species
aml04217  Necroptosis
aml04722  Neurotrophin signaling pathway
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05012  Parkinson disease
aml05014  Amyotrophic lateral sclerosis
aml05016  Huntington disease
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100471095 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100471095 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100471095 (BAX)
   04215 Apoptosis - multiple species
    100471095 (BAX)
   04217 Necroptosis
    100471095 (BAX)
   04115 p53 signaling pathway
    100471095 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100471095 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    100471095 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471095 (BAX)
   05202 Transcriptional misregulation in cancer
    100471095 (BAX)
   05203 Viral carcinogenesis
    100471095 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100471095 (BAX)
   05212 Pancreatic cancer
    100471095 (BAX)
   05225 Hepatocellular carcinoma
    100471095 (BAX)
   05226 Gastric cancer
    100471095 (BAX)
   05214 Glioma
    100471095 (BAX)
   05216 Thyroid cancer
    100471095 (BAX)
   05220 Chronic myeloid leukemia
    100471095 (BAX)
   05217 Basal cell carcinoma
    100471095 (BAX)
   05218 Melanoma
    100471095 (BAX)
   05213 Endometrial cancer
    100471095 (BAX)
   05224 Breast cancer
    100471095 (BAX)
   05222 Small cell lung cancer
    100471095 (BAX)
   05223 Non-small cell lung cancer
    100471095 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100471095 (BAX)
   05014 Amyotrophic lateral sclerosis
    100471095 (BAX)
   05016 Huntington disease
    100471095 (BAX)
   05020 Prion disease
    100471095 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    100471095 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100471095 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100471095 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100471095 (BAX)
   05152 Tuberculosis
    100471095 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100471095 (BAX)
   05170 Human immunodeficiency virus 1 infection
    100471095 (BAX)
   05161 Hepatitis B
    100471095 (BAX)
   05160 Hepatitis C
    100471095 (BAX)
   05164 Influenza A
    100471095 (BAX)
   05162 Measles
    100471095 (BAX)
   05168 Herpes simplex virus 1 infection
    100471095 (BAX)
   05163 Human cytomegalovirus infection
    100471095 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100471095 (BAX)
   05169 Epstein-Barr virus infection
    100471095 (BAX)
   05165 Human papillomavirus infection
    100471095 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100471095 (BAX)
   01524 Platinum drug resistance
    100471095 (BAX)
   01522 Endocrine resistance
    100471095 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aml03029]
    100471095 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aml02000]
    100471095 (BAX)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100471095 (BAX)
Transporters [BR:aml02000]
 Other transporters
  Pores ion channels [TC:1]
   100471095 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 100471095
NCBI-ProteinID: XP_034528302
Ensembl: ENSAMEG00000014599
LinkDB
Position
12
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALEQVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggaacaacccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaagatcgagcagggcgaatgggggga
gagacacctgagctggccctggagcaggtgccccaggacgcatccaccaagaagctgagc
gagtgtctcaaacgcatcggagatgaactggacagtaacatggagttacagaggatgatc
gcagccgtggacacagactccccgcgcgaggtctttttccgagtggcagctgacatgttt
tccgatggcaacttcaactggggccgggttgttgccctcttctactttgccagcaaactg
gtgctcaaggccctgtgtaccaaggtgcccgagctgatcaggaccatcatgggctggaca
ctggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggacggc
ctcctctcctactttgggacacccacgtggcagacagtgaccatctttgtggctggagtg
ctcactgcgtcactcaccatctggaaaaagatgggctga

DBGET integrated database retrieval system