KEGG   Ailuropoda melanoleuca (giant panda): 100471122
Entry
100471122         CDS       T01329                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04012  ErbB signaling pathway
aml04066  HIF-1 signaling pathway
aml04072  Phospholipase D signaling pathway
aml04136  Autophagy - other
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04371  Apelin signaling pathway
aml04613  Neutrophil extracellular trap formation
aml04630  JAK-STAT signaling pathway
aml04659  Th17 cell differentiation
aml04714  Thermogenesis
aml04910  Insulin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04920  Adipocytokine signaling pathway
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05022  Pathways of neurodegeneration - multiple diseases
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05221  Acute myeloid leukemia
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05230  Central carbon metabolism in cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100471122 (MTOR)
   04371 Apelin signaling pathway
    100471122 (MTOR)
   04630 JAK-STAT signaling pathway
    100471122 (MTOR)
   04066 HIF-1 signaling pathway
    100471122 (MTOR)
   04072 Phospholipase D signaling pathway
    100471122 (MTOR)
   04151 PI3K-Akt signaling pathway
    100471122 (MTOR)
   04152 AMPK signaling pathway
    100471122 (MTOR)
   04150 mTOR signaling pathway
    100471122 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100471122 (MTOR)
   04136 Autophagy - other
    100471122 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100471122 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100471122 (MTOR)
   04659 Th17 cell differentiation
    100471122 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100471122 (MTOR)
   04920 Adipocytokine signaling pathway
    100471122 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    100471122 (MTOR)
   04919 Thyroid hormone signaling pathway
    100471122 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100471122 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100471122 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100471122 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471122 (MTOR)
   05206 MicroRNAs in cancer
    100471122 (MTOR)
   05205 Proteoglycans in cancer
    100471122 (MTOR)
   05230 Central carbon metabolism in cancer
    100471122 (MTOR)
   05231 Choline metabolism in cancer
    100471122 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100471122 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100471122 (MTOR)
   05212 Pancreatic cancer
    100471122 (MTOR)
   05225 Hepatocellular carcinoma
    100471122 (MTOR)
   05226 Gastric cancer
    100471122 (MTOR)
   05214 Glioma
    100471122 (MTOR)
   05221 Acute myeloid leukemia
    100471122 (MTOR)
   05215 Prostate cancer
    100471122 (MTOR)
   05224 Breast cancer
    100471122 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100471122 (MTOR)
   05014 Amyotrophic lateral sclerosis
    100471122 (MTOR)
   05016 Huntington disease
    100471122 (MTOR)
   05017 Spinocerebellar ataxia
    100471122 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    100471122 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100471122 (MTOR)
   04931 Insulin resistance
    100471122 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100471122 (MTOR)
   05168 Herpes simplex virus 1 infection
    100471122 (MTOR)
   05163 Human cytomegalovirus infection
    100471122 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100471122 (MTOR)
   05165 Human papillomavirus infection
    100471122 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100471122 (MTOR)
   01522 Endocrine resistance
    100471122 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100471122 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100471122 (MTOR)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100471122 (MTOR)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100471122 (MTOR)
Membrane trafficking [BR:aml04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100471122 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 100471122
NCBI-ProteinID: XP_034527083
Ensembl: ENSAMEG00000009623
LinkDB
Position
11
AA seq 2548 aa
MLGTGPTAATAATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPPQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTALPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTVQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITSTSTAATTAATATATSTEGSNSESEAESTENSPT
PSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNE
ALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASK
STTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGE
RNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAW
DLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQ
VITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLS
IQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLM
QKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHP
SNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCH
TVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGV
ELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDV
PTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7647 nt   +upstreamnt  +downstreamnt
atgctgggaactggacccactgccgccaccgcagctaccaccacgtccagcaacgtgagc
gtcctgcagcagttcgccagtggcctgaagagccggaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaagaggagtct
actcgattctatgatcagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagccttataggagtggaaggcgggaat
gccactcggattggaagattcgctaactatcttcggaacctcctcccctcgaatgaccca
gttgtcatggagatggcatccaaggccattggccgcctcgccatggcaggggacactttt
acggctgagtatgtggagtttgaggtgaagcgagccttggagtggctgggtgctgaccgc
aacgagggccggagacacgccgctgttctggttctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagccgtggccgcccttcgtgcctgcctgattctcacc
acgcagcgtgagccgaaggagatgcagaagcctcagtggtaccggcacacgtttgaagaa
gcagagaaagggtttgatgagacattggccaaggagaaaggcatgaatcgggatgatcgc
atccacggagccttgctgatcctcaacgagttggtccgaatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagctcgtgcacgacaagtactgc
aaggacctcatgggcttcgggacgaaacctcgccacatcacccccttcaccagtttccag
gccgtccagcccccgcagtccaatgccttggtgggactgctggggtacagctctcaccaa
ggcctcatggggttcggggcttcccccagcccagcgaagtccaccctggtggagagtcgg
tgttgcagagacctgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaacagcaagaactcactgatccagatgacaatccttaatctgttgccccgcctggcc
gcgtttcgaccttctgccttcacagatacccagtacctccaagataccatgaaccatgtc
ttaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctgctt
tctgtggctgtgagatctgagtttaaggtctatttacctcgtgtgctggacatcatccgt
gcagccctaccccctaaggactttgcccataagagacagaaggccatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgggcaatggggccaggcatccaacaggat
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcactgctgtg
ctgtatgacctgagccgtcagattccgcagctgaagaaggacatccaggatgggctcctg
aagatgctgtccctggtcctgatgcacaaacccctccggcatccaggcatgcccaagggc
ctggcccatcagctagcttcccctggcctcacagccctgcctgaggccagcgatgtcggc
agcattactcttgccctgcgaacccttggcagctttgagtttgaaggccactctctgacc
cagttcgtccgccactgtgcggatcatttcctaaacagcgagcacaaggagatccgcatg
gaagctgcccgcacctgctcccgcctgctcacgccctctgtccacctcattagcggccac
gctcacgtggttagccagactgcagtgcaagtcgtggcagacgtgctcagcaaactgctc
gtggttgggataacagatcctgaccctgacatccgctactgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggcagagaatttgcaggccctgtttgtggccctg
aacgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagtagc
atgaacccagccttcgtcatgcctttcctgcgcaagatgcttatccagattttgacggag
ctggagcacagcggcattggaagaatcaaagagcagagtgcccgcatgctgggacacctg
gtctccaatgcaccccggctcatccgcccctacatggagcccattctgaaggctttaatt
ttgaaactgaaagatccggaccctgatccaaacccaggtgtgatcaataatgtcttggct
acaataggagaattggctcaggttagtggcctagaaatgaggaagtgggtggatgaactc
tttatcatcatcatggacatgctccaggactcctcgctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtagtggagccctacaggaag
taccccactctgcttgaggtcctgctgaattttctgaagactgagcagaaccagggtaca
cggagagaggctatccgtgtgttggggcttttgggggccctggatccctacaagcacaaa
gtaaacattggcatgattgaccagtcccgcgacgcttctgctgtcagcctgtctgaatcc
aagtcaagtcaggattcctccgactacagcaccagcgagatgctggtcaacatgggcaac
ctgcccctggatgagttctaccctgccgtgtccatggtggcgctgatgcggatcttccga
gaccagtccctctcgcaccatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggcctcaagtgtgtgcagttcctgcctcaggtcatgcccacattcctcaatgtc
attcgggtctgcgatggggccatccgggaattcctgttccagcagctgggaatgctggtg
tcctttgtgaagagccacatccgaccttacatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcgatccagagcacaatcatccttctcattgagcaaatagtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctacgt
gtcttcatgcatgacaacagcccaggtcgcatcgtctccatcaagctgttggccgccatc
cagctgtttggtgccaacctggatgactatctgcatttgttgttgccccctatcgtgaag
ctgtttgacgccccggaagtcccactgccatctcggaaggcagcattagagacagtggac
cgcctgacagagtccctggacttcactgactacgcctcccggatcattcatccaattgtt
cgaacgctggaccagagtccggaactgcgtcccacggccatggacacgttgtcttcgctg
gtcttccaactggggaagaagtaccagattttcattccaatggtgaacaaagtcctggtg
cgacaccgaatcaaccatcagcgctacgacgtcctcatctgcagaattgtcaagggatac
acccttgctgatgaagaagaggaccctttgatttaccagcatcgaatgctgaggagtggc
cagggggatgcattggctagtggcccagtagaaacagggcccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtgtccaaagatgactgg
ctggaatggctgaggcggctgagtctggagctcctgaaggactcctcgtcgccttccctg
cgctcgtgctgggccctggctcaggcttacaacccaatggccagggatctttttaatgcc
gcatttgtgtcctgctggtctgaactgaatgaagaccagcaggatgaactcatcagaagc
atcgagttggccctcacctcgcaggacatcgctgaagtcacgcagaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccctctgccattgagagacgacaatggcatt
gtcctgctgggtgaaagggctgccaagtgccgagcatatgccaaagcactccactacaaa
gaactggagttccagaaaggtcccacccccgccatcctagagtctctcatcagcattaat
aataagctccagcagccggaggcagccgcgggggtcttagagtatgccatgaaacacttc
ggagagctggagatccaggctacctggtacgagaaactgcacgagtgggaggacgcgctc
gtggcctacgacaagaagatggacaccaacaaggatgacccggagctgatgctgggccgc
atgcgctgcctcgaggccctgggggaatggggccagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccgcatggctgccgcagctgcg
tggggtttaggtcagtgggatagcatggaggagtacacctgtatgatccctcgggacacc
cacgatggggcattttacagagccgtgctggcactgcatcaggacctcttctccttggca
cagcagtgcatcgacaaagccagagacctgctggatgccgagttaactgctatggcagga
gagagctacagtcgggcatatggggctatggtctcttgccacatgctctccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctgatggtgcgg
tcacttgtggtcagccctcatgaggacatgaggacctggctcaagtatgccagcctgtgc
gggaagagtggcaggctggcccttgctcataaaaccttggtgttgctcctgggagttgat
ccatctcggcaacttgaccaccctctgccaacagttcaccctcaggtgacctacgcctac
atgaaaaacatgtggaagagcgctcgcaagatcgacgccttccagcacatgcagcacttc
gtacagaccgtgcagcagcaggcccagcacgccatcgccaccgaggaccagcagcacaag
caagagctgcacaagctcatggcccggtgcttcctgaagctcggggagtggcagctgaac
ctgcagggcatcaatgagagcaccatccccaaggtgctgcagtactacagcgcggccacg
gagcacgaccgcagctggtacaaggcctggcacgcgtgggcagtgatgaactttgaggct
gtgctgcactacaaacatcagaaccaagcccgtgatgagaagaagaagctgcggcacgcc
agtggggccaacatcaccagcacaagcactgccgccaccacagcggccactgccaccgcc
accagcaccgagggcagcaacagcgagagtgaggccgagagcaccgagaacagccccact
ccgtctcctctgcagaagaaggtcactgaggatttatccaaaaccctcttgatgtacacc
gtccctgcggtccagggcttcttccgttccatctccttgtcacgaggcaacaacctccag
gacacgctgagagtcctcaccttatggtttgactatggtcactggccagacgtaaatgaa
gccttagtggagggggtgaaagcaattcagattgacacttggttacaggttataccgcag
ctcatcgcaaggatcgatactcccaggcctttggtgggccgcctcattcaccagcttctc
acagacattggccggtaccacccgcaggccctcatctaccccctgaccgtggcctctaag
tccaccacgacggcccgccacaacgcagccaacaagattctgaagaacatgtgcgagcac
agtaataccctggtccagcaggccatgatggtgagcgaggagctaatccgcgtggccatc
ttgtggcacgagatgtggcacgaaggcctggaagaagcgtctcgtttgtactttggggaa
aggaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaacggggc
ccccagactctgaaggaaacatcttttaatcaggcgtatggtcgagacttaatggaggcc
caagagtggtgcaggaagtacatgaaatccgggaacgtcaaggacctcacccaagcctgg
gacctctattatcacgtgttcagacgaatctcgaagcagctgcctcagctcacctcctta
gaactgcagtatgtttcccccaaacttcttatgtgccgggaccttgaattggctgtgcca
gggacgtacgaccccaaccagccgatcattcgcattcagtccatagcgccgtccctgcag
gtcatcacctccaagcagaggccccggaagctgacactcatgggcagcaacgggcatgag
tttgttttcctcctgaagggccacgaagacctgcggcaggatgagcgagtgatgcagctc
tttggcctggtgaacactcttctggccaacgacccaacgtctcttcgcaagaacctcagc
atccagagatacgctgtcatccccttatcaaccaactcgggcctcatcggctgggtcccc
cactgcgacacgctgcacgccctcatccgggactacagagagaagaagaagatccttctc
aacatcgagcatcgcatcatgttgcggatggcaccagactacgatcacctgacgctgatg
cagaaggtggaggtgttcgagcacgccgtcaataacacggccggcgacgacctggccaag
ctgctgtggctgaagagccccagctccgaggtgtggtttgaccgaagaaccaactatacc
cgctctttagcggtcatgtccatggttgggtatattttgggcctgggagatcgacaccca
tccaacctaatgctggaccggctgagtgggaagatcctgcacatcgactttggggactgc
tttgaggttgctatgaccagggagaaattcccagagaagattccatttagactaacaaga
atgctgaccaatgctatggaggttactggtctggatggcaactatagaatcacgtgccac
acggtgatggaagtgcttcgggaacacaaggatagtgtcatggccgtgctggaagccttt
gtctacgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaagcgg
tcccgaacaaggacggattcctactctgctggacagtcagtagaaattttggacggtgtg
gaacttggggaacctgcccataagaaaacagggaccacagtgccagaatctattcattct
ttcattggagacggtttggtgaaaccagaggccctaaataagaaagctattcaaattatt
aacagggttcgagacaagctcactggtcgggacttttctcatgacgaaaccctggatgtc
ccaacacaggtggagctgctcatcaaacaagcaacgtcccacgagaacctctgtcaatgc
tacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system