KEGG   Ailuropoda melanoleuca (giant panda): 100471182
Entry
100471182         CDS       T01329                                 

Gene name
FOXO1
Definition
(RefSeq) LOW QUALITY PROTEIN: forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04218  Cellular senescence
aml04910  Insulin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100471182 (FOXO1)
   04152 AMPK signaling pathway
    100471182 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100471182 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100471182 (FOXO1)
   04922 Glucagon signaling pathway
    100471182 (FOXO1)
   04919 Thyroid hormone signaling pathway
    100471182 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    100471182 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    100471182 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471182 (FOXO1)
   05202 Transcriptional misregulation in cancer
    100471182 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100471182 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100471182 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100471182 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100471182 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100471182 (FOXO1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100471182 (FOXO1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 100471182
NCBI-ProteinID: XP_034519677
LinkDB
Position
7
AA seq 558 aa
AAAAATGGLCGDXQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAGGPLAGQPRKSSSSRR
NAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNL
SLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASL
QSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDD
LGDGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTPLTVSTQSSPGT
MMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPMQTLQDNKSSYGGMNQYNC
APGLLKELLTSDSPPHNDIMTAVDPGVAQPNSRVLGQNVLMGPNSVMSTYGSQASHNKMM
NPSSHTHPGHTQPTSAVNGRALPHTVNTMPHTSGMNRLAPVKTALQVPLSHPMQMNTLGA
YSSVSSCNGYGRMGILHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLP
NQSFPHSVKTTTHSWVSG
NT seq 1677 nt   +upstreamnt  +downstreamnt
gccgcagctgccgccaccggggggctgtgcggggacnntcagggcccggaggcaggctgc
ctgcacccggcgccgccgcagcctccgccacccgggccgctgtcgcagcacccgccggtg
cccccagccgccggcgggccgctcgcggggcagccgcgaaagagcagctcgtcccgccgc
aacgcgtggggcaacctgtcctacgccgacctcatcaccaaggccatcgagagctcagcg
gagaagcggctcacgctgtcgcagatctacgagtggatggtcaagagcgtgccctacttc
aaggataagggtgacagcaacagctcggcgggttggaagaattcaattcgccataatctg
tccctacacagcaagttcattcgtgtgcagaatgaagggactggaaaaagttcttggtgg
atgctcaatccagagggaggcaagagtggaaaatccccccggagaagagctgcttccatg
gacaacaatagtaaatttgctaagagccggggccgggctgctaagaaaaaagcatctctc
cagtctggccaggagggtgctggggacagcccaggatctcagttttctaagtggcctgcg
agccctggctctcacagcaacgatgactttgataactggagtacatttcgccctcgaact
agctcaaatgctagtactattagtgggagactttctcccattatgaccgaacaggatgat
cttggagatggggatgtgcattctatggtgtacccaccatctgctgcaaagatggcctct
actctacccagtctgtctgagataagcaatcctgaaaatatggaaaatcttttggataat
ctcaaccttctctcatcaccaacgccattaactgtttcgacccagtcttcacctggcacc
atgatgcagcagacaccgtgctactcatttgcaccgccaaacaccagtctgaattcaccc
agcccaaactaccaaaaatatacatatggccagtccagcatgagccctttgccccagatg
cctatgcaaacgcttcaggacaacaaatcgagctatggaggtatgaatcagtataactgt
gcacctggactcttgaaggagttgcttacttctgactctcctccccataatgacattatg
acagcagttgatcctggggtcgcccaacccaacagccgggtccttggtcagaatgtgttg
atgggccctaattcggtcatgtcaacctatggcagccaggcatctcataacaaaatgatg
aaccccagctcccacacccaccctggacatacccagccaacatctgcagttaatgggcgt
gccttgccccacacggtcaacaccatgccccacacctcgggtatgaaccgcttggcccca
gtgaagacagctttacaagtgcctctgtcccaccccatgcagatgaacaccctgggggcc
tactcctcagtgagcagctgcaatggctatggcaggatgggcattctccaccaagagaag
ctccccagtgacttggatggcatgtttattgagcgcttggactgtgacatggagtccatt
attcggaacgacctcatggatggagatactttggattttaactttgacaatgtgttgccc
aaccaaagcttcccgcacagcgtcaagacgacgacacatagctgggtgtcaggctaa

DBGET integrated database retrieval system