KEGG   Ailuropoda melanoleuca (giant panda): 100471334
Entry
100471334         CDS       T01329                                 

Gene name
EGR3
Definition
(RefSeq) early growth response protein 3 isoform X1
  KO
K12497  early growth response protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04625  C-type lectin receptor signaling pathway
aml05161  Hepatitis B
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100471334 (EGR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100471334 (EGR3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100471334 (EGR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100471334 (EGR3)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100471334 (EGR3)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 DUF3446 zf-C2H2_4 zf-BED zf-C2HC_2 zf-H2C2_5
Other DBs
NCBI-GeneID: 100471334
NCBI-ProteinID: XP_002914816
LinkDB
Position
5
AA seq 386 aa
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVAHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPQGDVEAMYPALPPYSNCSDLYSEPVSFHDPQGNPGLAYSPQDYQSAKP
ALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHP
GFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTG
HKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEK
KAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctctggcagcagc
gactcggtagcccattacaatcagatggctacagagaatgtgatggacatcggtctgacc
aacgagaagcccaacccggaactctcttattcgggctccttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgtcaggac
aacatcattagcctcatgagcgccggcatcttgggggtgcccccggcctcaggggcactc
agcacgcagacctccacggccagcatggtgcagccgcagggcgacgtggaggccatgtat
ccggcgctgcccccctattctaactgcagtgatctctactcggagcctgtgtctttccac
gacccgcagggcaaccccgggctcgcctattccccccaggattaccaatcggccaagccg
gccttggacagcaatcttttccccatgattcctgactacaacctataccaccaccccaac
gatatgggctccattccggagcacaagcccttccagggcatggaccccatccgggtcaac
ccgccccctattaccccgctggagaccatcaaggcattcaaagacaagcagatccacccg
ggctttggcagcctgccccagccgccgctcacgctcaagcccatccggccccgcaagtat
cccaaccgacccagcaagaccccgctccacgagcggccccacgcgtgcccggcggagggc
tgcgaccgccgtttcagccgctcggacgagctgacccggcacctgcgcatccacactggc
cacaagcccttccagtgccggatctgcatgcggagcttcagtcgcagcgaccaccttacc
acccacatccgcacgcacacgggcgagaagccctttgcctgcgagttctgcgggcgcaag
tttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggagaag
aaggcggagaaggggggtgcgccctctgcgtcttcggcgccccccgtgtccctggcccct
gtggtcaccacctgcgcctga

KEGG   Ailuropoda melanoleuca (giant panda): 100479556
Entry
100479556         CDS       T01329                                 

Gene name
EGR2
Definition
(RefSeq) E3 SUMO-protein ligase EGR2 isoform X2
  KO
K12496  early growth response protein 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04625  C-type lectin receptor signaling pathway
aml05161  Hepatitis B
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100479556 (EGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100479556 (EGR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100479556 (EGR2)
   05161 Hepatitis B
    100479556 (EGR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100479556 (EGR2)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100479556 (EGR2)
SSDB
Motif
Pfam: DUF3446 zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2HC_2 zf-BED zf-H2C2_5 Zf_RING
Other DBs
NCBI-GeneID: 100479556
NCBI-ProteinID: XP_011217860
Ensembl: ENSAMEG00000003682
LinkDB
Position
6
AA seq 421 aa
MNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPE
GIINIVSAGILQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPP
PPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFP
SQCQRDLHGTAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPSVGPTGPGASGGSEG
PRLPGSSSAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSD
ELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKR
HTKIHLRQKERKSSAPSSSVPAASTASCSGGSQPGGALCNSNGGSIGGGSLASCSSRTRT
P
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaacggagtggccggagatggcatgatcaacattgacatgactggagagaagaggtcc
ttggatctcccgtatcccagcagctttgctcccgtctctgcacctagaaaccagaccttc
acgtacatgggcaagttctccattgacccccagtaccctggtgccagctgctacccagaa
ggcatcatcaatattgtgagtgcaggcatcctgcaaggggttacctccccagcttcgacc
acagcctcgtccagcgtcacctctgcctcccccaacccactggccacaggacccctgggt
gtgtgcaccatgtctcagacccagcctgacctggaccacctctactctccaccaccaccg
cctccttattctggctgtgcaggagacctctaccaggacccctcagcattcctgtcagca
gccaccacctccacctcctcctctctggcctacccaccacctccttcctacccctcccct
aagccagccacggaccctggtctctttcctatgatcccagactatcctggattcttccca
tcacagtgccagagagacctacatggtacagctggcccagaccgcaaacccttcccctgc
cctctggactccttgcgagtccctcctccactcactccgctctccaccattcgtaacttt
accctggggggccccagcgttgggcccacagggccaggggccagtggaggcagcgaggga
ccccggctgcctggcagcagctcagccgccgctgcagccgcctataaccctcaccacctg
ccactgcggcccattctgaggcctcgcaagtaccccaacaggcctagcaagaccccagtg
cacgagaggccctacccgtgcccagcagaaggctgtgaccgacgcttctcccgctctgac
gagctgacccgacacatccgaatccacacgggacacaagcccttccagtgtcggatttgc
atgcgcaacttcagccgcagtgaccacctcactacccacatccgcacccacactggtgag
aagccctttgcctgtgactactgcggccgcaagtttgcccggagcgacgagaggaagcgc
cacaccaagatccacctgagacagaaggagcgcaagagcagtgcgccctcctcctccgtg
ccggccgcctccacggcctcctgctccggaggctcgcagcctgggggggccctgtgcaac
agcaacggcggcagcattggcggagggtccctggcctcttgctcctctcggacccggaca
ccttga

DBGET integrated database retrieval system