KEGG   Ailuropoda melanoleuca (giant panda): 100471374
Entry
100471374         CDS       T01329                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04114  Oocyte meiosis
aml04140  Autophagy - animal
aml04144  Endocytosis
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04510  Focal adhesion
aml04520  Adherens junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04730  Long-term depression
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05205  Proteoglycans in cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100471374 (IGF1R)
   04014 Ras signaling pathway
    100471374 (IGF1R)
   04015 Rap1 signaling pathway
    100471374 (IGF1R)
   04066 HIF-1 signaling pathway
    100471374 (IGF1R)
   04068 FoxO signaling pathway
    100471374 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100471374 (IGF1R)
   04152 AMPK signaling pathway
    100471374 (IGF1R)
   04150 mTOR signaling pathway
    100471374 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100471374 (IGF1R)
   04140 Autophagy - animal
    100471374 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100471374 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100471374 (IGF1R)
   04520 Adherens junction
    100471374 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100471374 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100471374 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100471374 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100471374 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100471374 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100471374 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100471374 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100471374 (IGF1R)
   05205 Proteoglycans in cancer
    100471374 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100471374 (IGF1R)
   05214 Glioma
    100471374 (IGF1R)
   05218 Melanoma
    100471374 (IGF1R)
   05215 Prostate cancer
    100471374 (IGF1R)
   05224 Breast cancer
    100471374 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100471374 (IGF1R)
   01522 Endocrine resistance
    100471374 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100471374 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:aml04090]
    100471374 (IGF1R)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100471374 (IGF1R)
Protein kinases [BR:aml01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100471374 (IGF1R)
CD molecules [BR:aml04090]
 Proteins
  100471374 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 Insulin_TMD
Other DBs
NCBI-GeneID: 100471374
NCBI-ProteinID: XP_034523816
Ensembl: ENSAMEG00000005572
LinkDB
Position
9
AA seq 1366 aa
MKSGSGGGSPTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPTCPPNTYRFEGWRCVDRDFCANIPSAESSDSEGFVIHD
GECMQDCPSGVCRARPQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELESFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNHIILRWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVDPGILLQGLKPWTQYAVYVKAVTLTMVNDHIRGAKSEI
LYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRHN
YCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKV
FENFLHNSIFVPRPERKRRDVTQITNTTMSSRGRNSTVADTYNITDPEELETEYPFFESR
VDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWE
SRPENSIFLKWPEPENPNGLILMYEIKYGSQIEDQRECVSRQEYRKYGGAKLNRLNPGNY
TARIQATSLSGNGSWTDPVFFYVPAKITYENFIHLIIALPVAVLLIVGGLVIMLYVFHRK
RNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGV
VKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMEL
MTRGDLKSYLRSLRPEIENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNC
MVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVV
LWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLE
IIGSIKDEMEPGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSSSLPPPDRHS
GHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4101 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttttctcc
gccgcgctctcgctctggccgacgagtggagaaatctgcgggccgggcatcgacatccgc
aacgactatcagcagctgaagcgtctggagaactgcacggtgatcgagggctacctccac
atcttgctcatctccaaggcagaggactaccgcagctaccgcttccccaagctcacggtc
atcaccgagtacctgctgctgttccgcgtggccggcctcgagagcctcggggacctcttc
ccgaacctcacggtcatccgcggctggaagctcttttacaattacgccctggtcatcttc
gagatgaccaatctcaaggatattgggctttacaatctgaggaacattactcggggggcc
atcaggattgagaaaaatgccgacctctgttacctctccacggtggactggtccctgatc
ctggacgcggtgtccaataactacatcgtggggaacaaacccccaaaggaatgcggggac
ctgtgtccggggacgatggaggagaagcccttgtgcgagaagacgaccatcaacaacgag
tacaactaccgctgctggactacaaaccgctgccagaaaatgtgcccgagcgcgtgcggg
aagcgagcgtgcaccgagaacaacgagtgctgtcaccccgagtgtctgggcagctgcagc
gcgccggacaacgacacggcctgcgtggcctgcaggcattactactacgccggcgtctgc
gtgcccacctgcccgcccaacacctaccgcttcgagggctggcgctgcgtggaccgcgac
ttctgcgccaacatccccagcgccgagagcagcgactccgaggggttcgtgatccacgac
ggcgagtgcatgcaggactgcccctctggggtgtgccgggcaaggccacagagcatgtac
tgcatcccttgcgaaggtccttgccccaaggtctgtgaggaagaaaagaaaacaaagacc
attgattctgttacctctgctcaaatgctccaaggatgcaccatcttcaagggcaatttg
ctcattaatatccgccgaggcaataacattgcctcggaactggagagtttcatggggctc
atcgaggtggtgacgggctacgtgaagattcgccattcccacgccttggtctccttgtcc
ttcctaaaaaaccttcgccagatcttaggagaggagcagctggaggggaactactccttc
tacgtcctcgacaaccagaacttgcagcagctgtgggactgggaccaccgcaacctgacc
atcaaagctgggaaaatgtactttgctttcaatcccaagttgtgcgtctccgagatttac
cgcatggaggaagtgacagggactaaggggcgccagagcaaaggggacataaacaccagg
aacaacggagagcgagcctcctgtgaaagcgacgtcctgcacttcacctctacgaccacg
tggaagaatcacatcatcctaaggtggcaccgttaccggccccctgactacagggacctc
atcagtttcaccgtctactacaaggaggcaccttttaaaaacgtcacagagtacgatggg
caggatgcctgtggctccaacagctggaacatggtggatgtggacctccctcccaacaag
gacgtcgatcctggcattttactgcagggactgaagccctggacgcagtatgccgtgtat
gtcaaggcggtgaccctcaccatggtgaacgaccacatccgtggggccaagagtgaaatc
ttgtacattcgtaccaatgcttcagttccttccattcccctggacgttctttccgcgtcc
aactcgtcttctcagctcatcgtgaagtggaacccgccgtccctgcccaacgggaacctc
agttactacatcgtgaggtggcagcggcagcctcaggacagctacctgtaccggcacaat
tactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacatcgaa
gaggtgacggagaatcccaagaccgaggtgtgcggcggagagaaggggccttgctgcgcc
tgccccaaaaccgaggctgagaagcaggccgagaaggaggaggccgagtaccgcaaagtc
ttcgagaacttcctgcacaactccatctttgtgcccagaccggaaaggaagcggagagac
gtcacacaaatcaccaacaccaccatgtccagccgaggcaggaacagcacggtggcagac
acctataatatcacagacccagaagagctcgagacagaataccctttctttgagagcaga
gtggataacaaggagagaactgtaatctctaacctccggccttttactttgtaccgtatt
gacatccacagctgtaaccatgaggctgagaagctgggctgcagtgcctccaactttgtt
tttgcaagaaccatgcctgcagaaggagcagatgatattcctgggccggtgacctgggag
tcgaggcctgaaaactccatctttctaaagtggccagaacctgagaatcccaatggattg
attctaatgtatgaaataaaatacggatcacaaatcgaggatcagcgggaatgtgtatcc
agacaggagtacaggaaatatggaggcgccaagcttaaccggctcaacccggggaactat
acagcccggatccaggccacctctctctctgggaatgggtcctggacggatcctgtgttc
ttctatgtcccagccaaaataacgtatgaaaacttcatccatctgatcatcgctctgccc
gttgctgtcctgttgatagtgggagggctggttataatgctgtacgtcttccacaggaaa
agaaataacagcaggctggggaatggagtgctgtacgcgtccgtgaacccggagtacttc
agtgcagccgacgtgtacgtacctgacgagtgggaggttgctcgagagaagatcaccatg
agccgagagctgggccagggctcctttgggatggtatatgaaggagtcgccaaaggcgtg
gttaaagatgagcccgaaaccagggtggccattaaaacagtgaacgaggctgcgagcatg
cgtgaaaggattgaatttctcaatgaggcttcagtgatgaaggagttcaattgtcaccat
gtggtgcggttgctgggcgtggtgtcccagggccagccgacgctggtcatcatggaactg
atgacacggggggatctcaaaagctatctcaggtctctgaggccagaaatagagaataat
ccagtcctagcacctccaagcctgagcaagatgatccagatggctggggagattgcagat
ggcatggcatacctcaacgctaacaagtttgtccacagagaccttgctgcccggaactgc
atggtggccgaagatttcacagtcaaaatcggagatttcggtatgacaagagacatctat
gagacagactattaccggaaaggaggaaaggggctgctgcctgtgcgttggatgtcccct
gagtctctcaaggatggagtcttcaccactcactctgatgtctggtccttcggggtcgtg
ctctgggagattgccacgctggccgagcagccataccagggcttgtccaacgagcaggtc
cttcgcttcgtgatggagggcggccttctggacaagccggacaactgccccgacatgctg
tttgaactgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttcctggag
atcatcggcagcatcaaggacgagatggagcccggcttccgggaggtctccttctactac
agcgaggagaacaagccgcccgagccggaggagctggacctggagcccgagaacatggag
agcgtccccctggacccctccgcctcctcgtcctccctgccgccgcccgacagacactca
ggacacaaggccgagaacggcccaggccccggcgtgctggtcctccgagccagtttcgat
gagagacagccttacgcgcacatgaacgggggccgcaagaacgagagggccttgcctctg
ccccagtcttcgacctgctga

DBGET integrated database retrieval system