Ailuropoda melanoleuca (giant panda): 100471563 Help Entry 100471563         CDS       T01329                                  Gene name TNF Definition (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01523   Antifolate resistance aml04010   MAPK signaling pathway aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04064   NF-kappa B signaling pathway aml04071   Sphingolipid signaling pathway aml04150   mTOR signaling pathway aml04210   Apoptosis aml04217   Necroptosis aml04350   TGF-beta signaling pathway aml04380   Osteoclast differentiation aml04612   Antigen processing and presentation aml04620   Toll-like receptor signaling pathway aml04621   NOD-like receptor signaling pathway aml04622   RIG-I-like receptor signaling pathway aml04625   C-type lectin receptor signaling pathway aml04640   Hematopoietic cell lineage aml04650   Natural killer cell mediated cytotoxicity aml04657   IL-17 signaling pathway aml04660   T cell receptor signaling pathway aml04664   Fc epsilon RI signaling pathway aml04668   TNF signaling pathway aml04920   Adipocytokine signaling pathway aml04930   Type II diabetes mellitus aml04931   Insulin resistance aml04932   Non-alcoholic fatty liver disease aml04933   AGE-RAGE signaling pathway in diabetic complications aml04940   Type I diabetes mellitus aml05010   Alzheimer disease aml05014   Amyotrophic lateral sclerosis aml05020   Prion disease aml05022   Pathways of neurodegeneration - multiple diseases aml05132   Salmonella infection aml05133   Pertussis aml05134   Legionellosis aml05135   Yersinia infection aml05140   Leishmaniasis aml05142   Chagas disease aml05143   African trypanosomiasis aml05144   Malaria aml05145   Toxoplasmosis aml05146   Amoebiasis aml05152   Tuberculosis aml05160   Hepatitis C aml05161   Hepatitis B aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05165   Human papillomavirus infection aml05166   Human T-cell leukemia virus 1 infection aml05168   Herpes simplex virus 1 infection aml05169   Epstein-Barr virus infection aml05170   Human immunodeficiency virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05205   Proteoglycans in cancer aml05310   Asthma aml05321   Inflammatory bowel disease aml05322   Systemic lupus erythematosus aml05323   Rheumatoid arthritis aml05330   Allograft rejection aml05332   Graft-versus-host disease aml05410   Hypertrophic cardiomyopathy aml05414   Dilated cardiomyopathy aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100471563 (TNF)    04350 TGF-beta signaling pathway     100471563 (TNF)    04064 NF-kappa B signaling pathway     100471563 (TNF)    04668 TNF signaling pathway     100471563 (TNF)    04071 Sphingolipid signaling pathway     100471563 (TNF)    04150 mTOR signaling pathway     100471563 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100471563 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     100471563 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100471563 (TNF)    04217 Necroptosis     100471563 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100471563 (TNF)    04620 Toll-like receptor signaling pathway     100471563 (TNF)    04621 NOD-like receptor signaling pathway     100471563 (TNF)    04622 RIG-I-like receptor signaling pathway     100471563 (TNF)    04625 C-type lectin receptor signaling pathway     100471563 (TNF)    04650 Natural killer cell mediated cytotoxicity     100471563 (TNF)    04612 Antigen processing and presentation     100471563 (TNF)    04660 T cell receptor signaling pathway     100471563 (TNF)    04657 IL-17 signaling pathway     100471563 (TNF)    04664 Fc epsilon RI signaling pathway     100471563 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100471563 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     100471563 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100471563 (TNF)   09163 Immune disease    05310 Asthma     100471563 (TNF)    05322 Systemic lupus erythematosus     100471563 (TNF)    05323 Rheumatoid arthritis     100471563 (TNF)    05321 Inflammatory bowel disease     100471563 (TNF)    05330 Allograft rejection     100471563 (TNF)    05332 Graft-versus-host disease     100471563 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     100471563 (TNF)    05014 Amyotrophic lateral sclerosis     100471563 (TNF)    05020 Prion disease     100471563 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     100471563 (TNF)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100471563 (TNF)    05410 Hypertrophic cardiomyopathy     100471563 (TNF)    05414 Dilated cardiomyopathy     100471563 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100471563 (TNF)    04940 Type I diabetes mellitus     100471563 (TNF)    04932 Non-alcoholic fatty liver disease     100471563 (TNF)    04931 Insulin resistance     100471563 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     100471563 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     100471563 (TNF)    05135 Yersinia infection     100471563 (TNF)    05133 Pertussis     100471563 (TNF)    05134 Legionellosis     100471563 (TNF)    05152 Tuberculosis     100471563 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100471563 (TNF)    05170 Human immunodeficiency virus 1 infection     100471563 (TNF)    05161 Hepatitis B     100471563 (TNF)    05160 Hepatitis C     100471563 (TNF)    05171 Coronavirus disease - COVID-19     100471563 (TNF)    05164 Influenza A     100471563 (TNF)    05168 Herpes simplex virus 1 infection     100471563 (TNF)    05163 Human cytomegalovirus infection     100471563 (TNF)    05169 Epstein-Barr virus infection     100471563 (TNF)    05165 Human papillomavirus infection     100471563 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     100471563 (TNF)    05144 Malaria     100471563 (TNF)    05145 Toxoplasmosis     100471563 (TNF)    05140 Leishmaniasis     100471563 (TNF)    05142 Chagas disease     100471563 (TNF)    05143 African trypanosomiasis     100471563 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100471563 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:aml04052]     100471563 (TNF)    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100471563 (TNF) Cytokines and growth factors [BR:aml04052]  Cytokines   Tumor necrosis fators    100471563 (TNF) Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Cytokines    100471563 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  100471563 NCBI-ProteinID:  XP_002930078 Ensembl:  ENSAMEG00000009478 UniProt:  D2I4B3 LinkDB All DBs Position 5 AA seq 233 aa AA seqDB search MSTESMIRDVELAEESLPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR EELPDGLQLINPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELT DNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE TAEGTEAKPWYEPIYLGGVFQLERGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggagtcactccccaagaag gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctc gtcgcaggagccaccacgctcttctgcctgctgcacttcggcgtgatcggcccccagagg gaagagctcccagatggactccaactaatcaaccctctggcccagacagtcaaatcatct tctcgaactccgagtgacaagcctgtagctcatgttgtagcaaaccccgaagctgagggg caactccagtggctgagccggcgtgccaatgccctcctggccaatggtgtggagctgaca gacaaccagctaatagtgccatcagacgggctgtacctcatctactcccaggtcctcttc aagggccagggatgcccttccacccatgtgctcctcacccacaccatcagccgcttcgct gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccaaagggag accgcagaggggactgaggccaagccctggtacgagcccatctacctgggaggggtcttc caactggagaggggtgatcgactcagcgctgagatcaacctgcctgactacctcgacttt gccgagtctgggcaggtctactttggaatcattgccctgtga

DBGET integrated database retrieval system