KEGG   Ailuropoda melanoleuca (giant panda): 100471855Help
Entry
100471855         CDS       T01329                                 

Gene name
TGM6
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100471855 (TGM6)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100471855 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100471855
NCBI-ProteinID: XP_011222707
Ensembl: ENSAMEG00000011376
LinkDB All DBs
Position
Un
AA seq 730 aa AA seqDB search
MPGHEGVMVMWTDGAGTRAVTSWVRAGIRVTEVDWLSQKNGAAHHTQEYPGPELVVRRGQ
AFTLVLELSRPLKDQETIIFTVETGPQASEDHHTKAVFQISEPEVDKTWTAVEEAQTENT
VTVSIASPPNAVIGRYLISTRVSSRRKQNDRKLGEFVLLFNPWCPEDDVFLDSEEERQEY
VLNDSGIIFRGVEKHIRAQGWNYGQFEEDILNICLSILDRSPLHQNDPATDVSRRHDPIY
VSRAISAMVNSNNDRGVVQGQWQGKYGGGTSPLHWSGSVAILHKWFKGRFKPVKYGQCWV
FAGVMCTVLRCLGIATRVVSNFNSAHDTDRNLSVDKYVDSFGRTLDDLSEDSMWNFHVWN
ESWFARQDLGPSYNGWQVLDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVN
ADYITWLWHEDESRERVYSDTKKIGRCLSTKAVGSDSRVDITGLYKYPEGSRKERQVYHK
AVRKLFSVEASGRRTRVRRGGGRGLWRDDLLEPAAKPNITGKFKMLEPPKLGHDLSLALC
LANLTSRAQRVRVNLSAATILYTRRPVAEILHESHSVRLGPEEEKQIPITISYSQYKEDL
TEDKKILLAAMCFVTKGEKLLVEKDITLEDCITIKVLGPAVVGVAVMVKVTVVNPLLERV
EDCVLMVEGSGLLQGQLSIDVPSLEPQERASVQFNITPSKSGPRQLQADLVSPHFPDIKG
FVVIHVATAK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtcacgagggtgtgatggtcatgtggacagacggcgcagggaccagagcagtg
acatcctgggtcagggcagggatcagagtcaccgaggtggactggctgagccagaagaac
ggtgctgcccaccacacccaggagtaccctggccctgagctggtggttcgcaggggccag
gcgttcaccttggtgctggagctgagcagacccctgaaggaccaggagaccatcatcttc
acggtggagacaggaccccaggcttctgaggaccaccacaccaaagctgtgttccagata
tcggagccagaagtggacaagacctggacggctgtggaagaggctcagacggagaacacc
gtgaccgtcagcatcgccagccctcccaacgctgtcatcggccgctatctgataagcacc
agggtctcctctcgccgaaaacagaatgaccggaagcttggcgaatttgttctccttttc
aacccgtggtgcccagaggacgacgtgtttctggactcagaggaggagagacaggagtac
gtgctcaatgacagcgggatcatcttccgaggcgtggagaagcacatccgagcccagggc
tggaactacgggcagttcgaggaggatatcctgaacatctgcctctccatcctggaccga
agtcctcttcaccaaaacgaccctgccaccgacgtgtcccgccgccacgaccccatctac
gtcagcagggccatcagtgccatggtgaacagcaacaatgaccggggcgtggttcaaggc
cagtggcagggcaagtacggaggcggcaccagccccctgcactggagtgggagcgtggcc
attctgcacaagtggttcaagggcaggttcaagccagtcaaatacggccagtgctgggtc
ttcgcgggagtcatgtgcacagtccttagatgcctggggatcgccacccgggtcgtgtcc
aactttaactcggcccatgacacggacaggaacctgagcgtggacaaatacgtggactcc
ttcgggcggacgctggacgacctgtcagaagacagcatgtggaatttccacgtctggaat
gagagctggtttgcccgccaggacctgggcccgtcttacaatggctggcaggttctggac
gccaccccccaggaggagagcgaaggcgtgttccggtgcggccccgcctccgtcaccgcc
atccgcgagggcgacgtgcacctggcgcacgacggcccctttgtgttcgcggaggtcaac
gcggactacatcacctggctgtggcacgaggatgagagccgggagcgggtgtactcggac
actaagaagatcgggaggtgcctcagcaccaaggccgtgggcagcgactcccgcgtggac
atcaccggcctctacaagtacccggaagggtcccggaaggagaggcaggtgtaccacaag
gccgtgaggaagctgttcagcgtggaagcctctgggaggaggacccgggtccgcaggggg
ggcggccgtggtctttggcgcgacgacctcctggagcccgcggccaagcccaacatcacc
ggcaagttcaagatgctggagccgcccaagctgggccacgacctgagcctggctctgtgc
ctggccaacctcacctcccgggcccagagggtccgagtcaacctgagcgctgccaccatc
ctgtatacccgcaggccggtggccgagatcctgcacgagtcccactcggtgcggctgggg
ccagaagaagagaaacagatcccaatcacaatatcttactctcagtataaggaagatctg
acagaggacaagaagatcctgttggctgccatgtgctttgtcaccaagggagagaagctc
ctggtggagaaggacatcactctggaggactgcatcaccatcaaggtgctgggccccgcc
gtggtgggggtggcggttatggtgaaagtgacggtggtcaacccccttctggagagagtg
gaggactgtgtgctgatggtggagggcagtggccttctccagggacagctcagcatcgat
gtgcccagcctggagccccaggagagggcctcggtccagttcaacattaccccatccaag
agcggcccacggcagctacaggcggacctcgtcagcccccacttcccggacatcaagggt
tttgtggtcatccacgtggccacagccaagtga

DBGET integrated database retrieval system