KEGG   Ailuropoda melanoleuca (giant panda): 100471928
Entry
100471928         CDS       T01329                                 

Gene name
PLAT
Definition
(RefSeq) tissue-type plasminogen activator
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04371  Apelin signaling pathway
aml04610  Complement and coagulation cascades
aml05202  Transcriptional misregulation in cancer
aml05215  Prostate cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100471928 (PLAT)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100471928 (PLAT)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100471928 (PLAT)
  09162 Cancer: specific types
   05215 Prostate cancer
    100471928 (PLAT)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100471928 (PLAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100471928 (PLAT)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100471928 (PLAT)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     100471928 (PLAT)
Peptidases and inhibitors [BR:aml01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100471928 (PLAT)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100471928 (PLAT)
SSDB
Motif
Pfam: Trypsin Kringle fn1 EGF DUF1986 Trypsin_2 cEGF
Other DBs
NCBI-GeneID: 100471928
NCBI-ProteinID: XP_002918408
Ensembl: ENSAMEG00000005307
LinkDB
Position
18
AA seq 563 aa
MNAMRRELVCVLLLCGAALTLSSQEIHPRFRRGARSYRGSCRDEKTQTLYVQNESWLRPG
LRGNRVEYCRCVGGRPQCHSVPVKSCSEPRCFNGGMCRQALYFSDFVCQCPEGFLGKRCE
IDASATCYKDQGITYRGTWSTAESGAECVNWNSSVLALKPYSGRRPDAVRLGLGNHNYCR
NPDRDSRPWCYVFKAGKYSSEFCSTPACPKEKNEDCYFGKGLAYRGTYSLTTSGASCLQW
SSIVLTGKVYTAWKTNSQALGLGNHNYCRNPDGDAKPWCHVLKDHKLTWEYCDVPQCSTC
GLRQYKQPQFRIKGGLYADITSHPWQAAIFVKNRRSPGERFFCGGILISSCWVLSAAHCF
QERYDPHHLRVVLGRTYREVPGEEEQKFEVEKYIIHEAFDDDTYNNDIVLLKLQSDSLHC
AQESDAVRTVCLPEANLQLPDWTECELSGYGKHEASSPFYSERLKEAHVRLYPSSRCTSQ
HLFNKTVTNNMLCAGDTRSGGNQANLHDACQGDSGGPLVCMKDNRMTLVGIISWGIGCGQ
KDVPGIYTKVINYLDWIQNNMRP
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgaatgcaatgaggagagagctggtgtgcgtcctgctgctttgcggagccgccctcacc
ttgtccagccaggaaatccacccccgattcagaagaggagccagatcttacagagggagc
tgcagagatgagaagacgcagacgctgtacgtgcagaacgagtcgtggctgcgcccgggg
ctgcggggcaaccgcgtggagtactgccgctgcgtgggcggccgcccgcagtgccactcg
gtgcccgtcaaaagttgcagcgagccgaggtgcttcaacggcgggatgtgtcggcaggct
ctctatttctccgattttgtctgccagtgccctgaagggtttctgggcaagcgctgtgaa
atagatgccagtgccacctgctataaggaccagggtatcacctacaggggcacgtggagc
acagcggaaagcggggctgagtgtgtcaactggaacagcagcgtgctggccctgaagccc
tacagcgggcggaggcccgacgcggtcaggctgggcctcgggaatcacaattactgcaga
aacccagaccgagactcaaggccctggtgctacgtcttcaaggcagggaagtacagcagt
gagttctgcagcacgcccgcctgccccaaggaaaaaaatgaggactgctactttggaaaa
gggttggcataccgtggcacctacagcctcaccacatctggtgcctcctgcctccagtgg
agttccatagtcctaacaggcaaggtctatacagcgtggaagaccaattctcaggccctg
ggcctgggcaaccacaattactgccggaacccagatggggatgccaagccttggtgccac
gtgctgaaggaccacaagttgacgtgggaatactgtgacgtgccccagtgctccacctgt
ggcctgagacagtacaagcagccgcagtttcgcattaaaggagggctctacgcggacatc
acctctcacccgtggcaggccgccatctttgtcaagaacaggaggtcaccaggagagagg
tttttttgtgggggaatactgatcagttcctgctgggtcctgtctgctgcccactgcttc
caggagaggtatgatccccaccaccttagggtggtcttgggcagaacataccgagaggtc
cctggagaggaggagcagaaatttgaagtcgaaaaatacatcatccatgaggcatttgat
gacgacacttacaacaatgatatcgtgctgctgaaactgcagtcggattcgctacactgt
gcccaggagagcgacgctgtccgcaccgtgtgtctccccgaggccaacctgcagctgccc
gactggacagaatgcgagctgtccggctacggcaagcacgaggcgtcttctcctttctat
tctgagcggctgaaggaggctcacgtccggctgtacccatccagccgctgcacatcacag
cacctgtttaacaaaaccgtcacgaacaacatgctgtgcgccggagacacgcgaagcggt
gggaaccaggcaaacctgcacgacgcctgccagggtgactcgggtggccccttggtgtgt
atgaaggacaaccgcatgactttggttggcatcatcagttggggcatcggctgcgggcag
aaagatgttcctggtatatataccaaggttattaattacctagactggattcaaaacaat
atgcgaccgtga

DBGET integrated database retrieval system