KEGG   Ailuropoda melanoleuca (giant panda): 100472031Help
Entry
100472031         CDS       T01329                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04080  Neuroactive ligand-receptor interaction
aml04972  Pancreatic secretion
aml04974  Protein digestion and absorption
aml05164  Influenza A
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100472031
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100472031
   04974 Protein digestion and absorption
    100472031
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100472031
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aml01002]
    100472031
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100472031
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100472031
Peptidases [BR:aml01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100472031
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100472031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 100472031
NCBI-ProteinID: XP_019660331
Ensembl: ENSAMEG00000006334
UniProt: G1LIB7
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MNPLLILAFVGAAVAFSTDDDDKIVGGYTCEENSVPYQVSLNVGYHFCGGSLISDQWVVS
AAHCYMYRIQVRLGVYNIDVMEGNEQFINSAKVIRHPRYSSWTLNNDIMLIKLSSPAVLN
KRVATVSLPSACAAAGTQCLISGWGNTLSSGSNYPELLQCLDAPLLSQAQCEASYPGQIT
DSMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAEKDSPGVYTKVCNFVDWIK
QTIAKHS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgattcttgcttttgtgggagctgctgttgctttctctactgacgac
gatgacaagatcgtcggtggctacacctgcgaggagaattccgtcccctaccaggtgtcc
ctgaacgtgggctaccacttctgtggtggctccctcatcagtgaccagtgggttgtgtcc
gcggctcactgctacatgtaccgcatccaagtgaggcttggagtgtacaacatcgacgtc
atggagggcaatgagcagttcatcaactcggccaaggtcatccgccacccccgctatagc
agctggaccctgaacaatgacatcatgcttatcaagctctcctcgcccgcagtcctcaac
aagcgggtggccaccgtctctctgccctccgcctgcgcggccgctggcacccagtgcctc
atctctggctggggcaacaccctgagctctggcagcaactaccccgagctgctacagtgt
ctggacgccccgctcctgagtcaggcccagtgcgaagcctcctaccccggccagatcaca
gacagcatggtttgcgctggcttcctcgagggaggcaaggactcctgccagggtgactct
ggtggccctgtggtgtgcaatggagagctccagggaatcgtctcctggggctacggctgc
gccgagaaggacagtcccggagtctacaccaaggtgtgcaactttgtagactggattaag
cagaccatagctaaacacagctga

DBGET integrated database retrieval system