KEGG   Ailuropoda melanoleuca (giant panda): 100472054
Entry
100472054         CDS       T01329                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04061  Viral protein interaction with cytokine and cytokine receptor
aml04062  Chemokine signaling pathway
aml04064  NF-kappa B signaling pathway
aml04072  Phospholipase D signaling pathway
aml04218  Cellular senescence
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05132  Salmonella infection
aml05133  Pertussis
aml05134  Legionellosis
aml05135  Yersinia infection
aml05142  Chagas disease
aml05144  Malaria
aml05146  Amoebiasis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05219  Bladder cancer
aml05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100472054 (CXCL8)
   04072 Phospholipase D signaling pathway
    100472054 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100472054 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100472054 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100472054 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100472054 (CXCL8)
   04621 NOD-like receptor signaling pathway
    100472054 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    100472054 (CXCL8)
   04657 IL-17 signaling pathway
    100472054 (CXCL8)
   04062 Chemokine signaling pathway
    100472054 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100472054 (CXCL8)
   05202 Transcriptional misregulation in cancer
    100472054 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    100472054 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100472054 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100472054 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100472054 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100472054 (CXCL8)
   05135 Yersinia infection
    100472054 (CXCL8)
   05133 Pertussis
    100472054 (CXCL8)
   05134 Legionellosis
    100472054 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100472054 (CXCL8)
   05171 Coronavirus disease - COVID-19
    100472054 (CXCL8)
   05164 Influenza A
    100472054 (CXCL8)
   05163 Human cytomegalovirus infection
    100472054 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100472054 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100472054 (CXCL8)
   05144 Malaria
    100472054 (CXCL8)
   05142 Chagas disease
    100472054 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100472054 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100472054 (CXCL8)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Chemokines
   100472054 (CXCL8)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Chemokines
   100472054 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100472054
NCBI-ProteinID: XP_002928540
Ensembl: ENSAMEG00000004830
LinkDB
Position
11
AA seq 101 aa
MTSKLAVALLAVFLLSSALCEAAVLSRMSSELRCQCIKTHSTPFHPKYIRELRVIESGPY
CENSEIIVKLVNGEEVCLDPKEPWVQKIVQIFLKRAEKQKP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctctcttggcagttttcctgctctcttcagcactgtgt
gaagctgcagttctgtcaagaatgagttcagaacttcgatgccagtgcataaagactcac
tctacccctttccatcccaaatatatcagagaactgagagtgattgagagtggtccgtat
tgtgaaaactcagaaatcattgtaaagcttgtcaatggagaagaggtgtgcctagacccc
aaggaaccatgggtacagaagattgtgcagatatttttgaagagggctgagaaacagaaa
ccatga

DBGET integrated database retrieval system