KEGG   Ailuropoda melanoleuca (giant panda): 100472074
Entry
100472074         CDS       T01329                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml04115  p53 signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04932  Non-alcoholic fatty liver disease
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05014  Amyotrophic lateral sclerosis
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05134  Legionellosis
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05222  Small cell lung cancer
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100472074
   04215 Apoptosis - multiple species
    100472074
   04115 p53 signaling pathway
    100472074
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100472074
  09162 Cancer: specific types
   05210 Colorectal cancer
    100472074
   05222 Small cell lung cancer
    100472074
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100472074
   05012 Parkinson disease
    100472074
   05014 Amyotrophic lateral sclerosis
    100472074
   05016 Huntington disease
    100472074
   05017 Spinocerebellar ataxia
    100472074
   05020 Prion disease
    100472074
   05022 Pathways of neurodegeneration - multiple diseases
    100472074
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100472074
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100472074
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100472074
   05134 Legionellosis
    100472074
   05152 Tuberculosis
    100472074
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100472074
   05161 Hepatitis B
    100472074
   05160 Hepatitis C
    100472074
   05164 Influenza A
    100472074
   05162 Measles
    100472074
   05168 Herpes simplex virus 1 infection
    100472074
   05163 Human cytomegalovirus infection
    100472074
   05167 Kaposi sarcoma-associated herpesvirus infection
    100472074
   05169 Epstein-Barr virus infection
    100472074
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100472074
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100472074
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 100472074
NCBI-ProteinID: XP_002912909
Ensembl: ENSAMEG00000006039
UniProt: D2GVD1
LinkDB
Position
1
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatacc
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtttatttggccgaaag
acaggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagacaggggaaagagcagacttgatagcttatctcaaa
aaagctactaaggagtaa

DBGET integrated database retrieval system