KEGG   Ailuropoda melanoleuca (giant panda): 100472171
Entry
100472171         CDS       T01329                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A isoform X3
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04218  Cellular senescence
aml04934  Cushing syndrome
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05212  Pancreatic cancer
aml05214  Glioma
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100472171
   04115 p53 signaling pathway
    100472171
   04218 Cellular senescence
    100472171
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100472171
   05206 MicroRNAs in cancer
    100472171
   05203 Viral carcinogenesis
    100472171
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100472171
   05225 Hepatocellular carcinoma
    100472171
   05214 Glioma
    100472171
   05220 Chronic myeloid leukemia
    100472171
   05218 Melanoma
    100472171
   05219 Bladder cancer
    100472171
   05223 Non-small cell lung cancer
    100472171
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100472171
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100472171
   05163 Human cytomegalovirus infection
    100472171
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100472171
   01522 Endocrine resistance
    100472171
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank Ank_2
Other DBs
NCBI-GeneID: 100472171
NCBI-ProteinID: XP_019652700
LinkDB
Position
7
AA seq 109 aa
MMMGSTRVAELLLLHGADPNCADPTTLTRPAHDAAREGFLDTLVVLHRAGARLDVRDAWG
RLPVDLAEERGHRAVAGYLRAAAGGTEAGSHASMEGAEGPADSPDLKND
NT seq 330 nt   +upstreamnt  +downstreamnt
atgatgatgggcagtacccgcgtggccgagctgctgctgctccatggcgcagaccccaac
tgcgccgaccccaccaccctcacccgacctgcgcacgacgcggcccgggagggcttcctg
gacacgctcgtggtgctgcaccgcgccggggcgcgtctggacgtgcgcgatgcctggggc
cgcctgcccgtggacctggctgaggagcggggccaccgcgctgtcgccgggtacctgcgc
gcagccgcggggggcactgaagctggtagccacgccagcatggaaggtgcggaaggcccg
gcagacagcccggacttaaagaatgattga

DBGET integrated database retrieval system