KEGG   Ailuropoda melanoleuca (giant panda): 100472241
Entry
100472241         CDS       T01329                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml04141  Protein processing in endoplasmic reticulum
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05160  Hepatitis C
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100472241 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100472241 (BAK1)
   04215 Apoptosis - multiple species
    100472241 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100472241 (BAK1)
   05202 Transcriptional misregulation in cancer
    100472241 (BAK1)
   05206 MicroRNAs in cancer
    100472241 (BAK1)
   05203 Viral carcinogenesis
    100472241 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100472241 (BAK1)
   05212 Pancreatic cancer
    100472241 (BAK1)
   05225 Hepatocellular carcinoma
    100472241 (BAK1)
   05226 Gastric cancer
    100472241 (BAK1)
   05214 Glioma
    100472241 (BAK1)
   05216 Thyroid cancer
    100472241 (BAK1)
   05220 Chronic myeloid leukemia
    100472241 (BAK1)
   05217 Basal cell carcinoma
    100472241 (BAK1)
   05218 Melanoma
    100472241 (BAK1)
   05213 Endometrial cancer
    100472241 (BAK1)
   05224 Breast cancer
    100472241 (BAK1)
   05222 Small cell lung cancer
    100472241 (BAK1)
   05223 Non-small cell lung cancer
    100472241 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100472241 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100472241 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100472241 (BAK1)
   05160 Hepatitis C
    100472241 (BAK1)
   05164 Influenza A
    100472241 (BAK1)
   05162 Measles
    100472241 (BAK1)
   05168 Herpes simplex virus 1 infection
    100472241 (BAK1)
   05163 Human cytomegalovirus infection
    100472241 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100472241 (BAK1)
   05169 Epstein-Barr virus infection
    100472241 (BAK1)
   05165 Human papillomavirus infection
    100472241 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100472241 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aml03029]
    100472241 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aml02000]
    100472241 (BAK1)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100472241 (BAK1)
Transporters [BR:aml02000]
 Other transporters
  Pores ion channels [TC:1]
   100472241 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 DUF5700
Other DBs
NCBI-GeneID: 100472241
NCBI-ProteinID: XP_034516450
Ensembl: ENSAMEG00000001363
LinkDB
Position
5
AA seq 211 aa
MASGQGPGPPRQECGETAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAAPADPEM
VSLSLEPSSTMGQVGRQLAIIGDDINQRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLIVLSLVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcatccgggcaaggcccaggtcctcccaggcaggagtgtggagagacggccccatct
tctacttctgaggagcaggtagcccgggacaccgaggaggttttccgcagctatgttttt
taccgccatcggcaggagcaggaggctgagggggcggctgcgcctgctgacccagaaatg
gtctccttgtccctagaacctagcagcaccatggggcaggtgggtcggcagctcgccatc
atcggggatgacatcaaccagcgctacgactctgagttccagaccatgctgcagcaccta
cagccaacagcagagaacgcctatgagtatttcaccaagatcgcctcgagcctgtttgag
agcggcatcaactggggccgagtggtggctctcctgggcttcggctaccgcctggcccta
cacgtctaccagcgtggactgaccggcttcctgggccaggtgacccgcttcgtagccgac
ttcatgctgcatcattgcattgcccggtggattgcgcagaggggcggctgggtggcagcc
ctgaacttgggaaatggccccatcctcaacgtgctgatagttctgtctttggttctcttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system