KEGG   Ailuropoda melanoleuca (giant panda): 100472815
Entry
100472815         CDS       T01329                                 

Gene name
TLR4
Definition
(RefSeq) toll-like receptor 4 isoform X1
  KO
K10160  toll-like receptor 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04064  NF-kappa B signaling pathway
aml04066  HIF-1 signaling pathway
aml04145  Phagosome
aml04151  PI3K-Akt signaling pathway
aml04217  Necroptosis
aml04613  Neutrophil extracellular trap formation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml05132  Salmonella infection
aml05133  Pertussis
aml05134  Legionellosis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05144  Malaria
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05162  Measles
aml05164  Influenza A
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05205  Proteoglycans in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05321  Inflammatory bowel disease
aml05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100472815 (TLR4)
   04066 HIF-1 signaling pathway
    100472815 (TLR4)
   04151 PI3K-Akt signaling pathway
    100472815 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100472815 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    100472815 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    100472815 (TLR4)
   04620 Toll-like receptor signaling pathway
    100472815 (TLR4)
   04621 NOD-like receptor signaling pathway
    100472815 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100472815 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100472815 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100472815 (TLR4)
   05321 Inflammatory bowel disease
    100472815 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100472815 (TLR4)
   05135 Yersinia infection
    100472815 (TLR4)
   05133 Pertussis
    100472815 (TLR4)
   05134 Legionellosis
    100472815 (TLR4)
   05152 Tuberculosis
    100472815 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100472815 (TLR4)
   05161 Hepatitis B
    100472815 (TLR4)
   05171 Coronavirus disease - COVID-19
    100472815 (TLR4)
   05164 Influenza A
    100472815 (TLR4)
   05162 Measles
    100472815 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100472815 (TLR4)
   05144 Malaria
    100472815 (TLR4)
   05145 Toxoplasmosis
    100472815 (TLR4)
   05140 Leishmaniasis
    100472815 (TLR4)
   05142 Chagas disease
    100472815 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100472815 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:aml04054]
    100472815 (TLR4)
   04090 CD molecules [BR:aml04090]
    100472815 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100472815 (TLR4)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100472815 (TLR4)
Pattern recognition receptors [BR:aml04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100472815 (TLR4)
CD molecules [BR:aml04090]
 Proteins
  100472815 (TLR4)
Glycosaminoglycan binding proteins [BR:aml00536]
 Hyaluronan
  Cell surface receptors
   100472815 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_1 LRR_5 LRR_9 LRR_6 DUF1863
Other DBs
NCBI-GeneID: 100472815
NCBI-ProteinID: XP_002929935
Ensembl: ENSAMEG00000005790
UniProt: G1LGR7
LinkDB
Position
7
AA seq 833 aa
MMSPTRRAGMLIPAMAFLSFLRPESWEPCEQVVPNITYKCMELNLNKIPNNIPTSTKKLD
LSFNPLRHLNSRSFSSFPELQVLDLSRCEIRIIEDDAYQGLNNLSILILTGNPIQELFPG
AFSGLSNLQTLVVVETNVQSLEDFPIGHLKTLKELNVAHNLIHSFKLPEYFSNMPNLEYL
DLSNNKIQNIYHKDLQVLRQMPLLNLSLDLSLNPLYFIQPGAFKEIKLHELTLRSNFNST
HVMKTCIQGLAGLKIHQLVLGEFKNERKLESFDKSLLEGLCDLTIEKFRIAYFDEFSKDT
TDLFNCLGNVSTISLVHLFLNRPRYLPKNLRWQRLEMVKCGFEEFPTWGLDSLKEFVFTA
NKGVNTFTEMNPNSLEFLDLSRNGLSFKGCCSHSELGTTRLKHLDLSFNDIITMSSNFLG
LEQLEYLDFQHSNLKQASDFSVFLSLRNLRYLDISYTHTQVVFQGIFDGLVSLQVLKMAG
NSFQDNFLPNIFKDLTNLTILDLSKCQLERVSQIAFGSLPKLQLINMSHNNLLSLDTLPY
EPLLSLQILDCSFNRIVASKERERQHFPSNLVSLNLTQNDFACVCEHQNFLQWVKDHRQL
LVEVEEMVCAKPLDMQGMPVLSFRNATCQRSKTIITVSVFTVLMVSLVAVLVYKFYFHLM
LLAGCKKYSKGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKSLL
RQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKPWSPEGAADAENS
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgatgtctcctacccgccgggcggggatgctgatcccagccatggccttcctctccttc
ctgagacccgagagctgggaaccttgtgagcaggtggttcctaacattacttacaaatgc
atggaactgaatctcaacaaaattcccaacaatatccccacgtcaaccaagaaactggac
ctgagctttaaccccctgaggcatttaaacagccgtagcttctccagcttcccagaactg
caggtgttggatttatccaggtgtgaaattcggataattgaagatgatgcatatcagggc
ctaaacaacctctccatcttgatattgacaggaaaccctatccaggagttattcccagga
gccttttctggactctcaaatttacagacgctggtggtcgtggagacaaatgttcagtct
ctagaggacttccccattggacatctcaaaaccttgaaggagcttaatgtggcccacaat
cttatccattccttcaagttacctgaatatttttctaacatgcccaacctggagtacttg
gatctttccaataacaagatccaaaatatttatcataaagacttgcaggttctgcgtcaa
atgcctctactcaacctttctttagacttgtccctgaaccctttatactttatccaacca
ggtgcctttaaagaaattaaactccatgaactgactttgagaagtaattttaatagtaca
catgtaatgaaaacttgtattcaaggtctggctggtttaaagatccatcagttggttctg
ggagaatttaaaaatgaaaggaagttggaaagctttgacaaatctctcctggagggactg
tgtgatttgaccattgaaaaattccggatagcatactttgatgagttctcaaaggatact
actgacttatttaattgtttgggaaatgtttctacaatttctctggtgcatctgttttta
aataggccaagataccttcctaaaaatctcagatggcaacggttggaaatggttaagtgt
ggatttgaagaatttcccacatgggggttggactctctcaaggagtttgttttcactgcc
aacaaaggtgtgaacacttttactgagatgaacccaaacagccttgagtttctagatctc
agtagaaatggcctgagttttaagggttgctgttctcactctgaattggggacaaccaga
ctgaagcatttagatctgagcttcaatgacattattaccatgagttcaaacttcttgggc
ttagaacaactagaatatctagatttccagcattccaatttgaaacaggccagtgatttt
tcagtattcctatccctcagaaacctccgttaccttgatatttcttatactcacacccaa
gttgtcttccagggcatttttgatggcctggtcagcctccaagtcttgaaaatggctggt
aattcttttcaggacaacttccttccaaatattttcaaagacctaactaacttgaccatt
ctagacctttctaagtgtcagctggaacgggtgtcccagatagcatttggttcacttccg
aaacttcagttgataaatatgagtcacaacaacctcctgtcattggatacactcccttat
gagcctctcctctccctccaaattctggattgcagttttaatcgaatagtggcctccaaa
gagcgagaacgacaacattttccaagtaatctagtttccttaaatcttactcagaatgac
tttgcttgtgtttgtgaacaccagaacttcctgcagtgggtcaaggaccacaggcagctc
ttggtggaagttgaagaaatggtgtgtgcaaaacctttagacatgcagggcatgcctgtg
ctgagttttaggaatgccacctgtcagaggagtaagactatcattactgtgtcggtgttc
actgtactcatggtttctctggtagcagttttggtgtataagttctatttccacctgatg
cttcttgctggctgcaaaaagtacagcaaaggcgaaagcacctatgatgccttcgttatc
tactcaagtcaagatgaagactgggtaaggaatgaactagtaaagaacttggaagagggg
gtgcccccctttcagctctgccttcattatagagactttattcctggtgtggccatcgcc
gccaacatcatccaggaaggtttccacaaaagccggaaggttattgttgtggtgtcccaa
cacttcatccagagtcgatggtgtatctttgagtatgagattgcccagacctggcagttt
cttagtagtcgtgccggcatcatcttcattgttctgcagaaggtggagaagtccctgctg
cggcagcaggtggagctgtatcggcttcttagcaggaacacttacctggagtgggaagac
agtgtcctggggcggcacatcttctggagacgactccgaaaagccttgctggatggtaaa
ccgtggagtccagaaggagcagcagatgcagaaaacagctag

DBGET integrated database retrieval system