KEGG   Ailuropoda melanoleuca (giant panda): 100473018
Entry
100473018         CDS       T01329                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100473018 (AXIN1)
   04390 Hippo signaling pathway
    100473018 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100473018 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473018 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100473018 (AXIN1)
   05225 Hepatocellular carcinoma
    100473018 (AXIN1)
   05226 Gastric cancer
    100473018 (AXIN1)
   05217 Basal cell carcinoma
    100473018 (AXIN1)
   05213 Endometrial cancer
    100473018 (AXIN1)
   05224 Breast cancer
    100473018 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100473018 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100473018 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100473018 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100473018 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100473018 (AXIN1)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100473018 (AXIN1)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind Sec16 Rootletin
Other DBs
NCBI-GeneID: 100473018
NCBI-ProteinID: XP_034526625
Ensembl: ENSAMEG00000007012
LinkDB
Position
10
AA seq 867 aa
MNIQEQGFPLDLGTTFTEDAPRPPVPGEEGELVSTDPRPVSHSFCSGKGVGVKGETSAAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLAKAIYRKYILDNNGIVSRQTKPATKSFIKDCIMKQLIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGVPGYLPT
LNEDEEWKCDQDQDEDGGRDPAPPGRLTQKLLLETAAPRASASRRYSEGREFRCGSWREP
VHPYYVSSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRGSLPHIPRTYRMPKEIRVEPQKFAAELIHRLEAIQRTREAEEKLEERLKRVRMEE
EGEDGDLPSGPPGASHKLPLAPAWHHFPPRYADVGCMALRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSAHVPKIVGVLGGVPSGHGKHAPKSGAKLDTAGLHLHRHGHHHGH
HSAARPKEQADAEAARRVQGSFAWGPELHGHAAKPRSHSESAGAAPNASDSLAYSGKAGT
ASRRNAKKTESGKNAGTEVPGPSEDTEKNQKILQWIMEGEKEISRHRKAGHGSSGAKKQQ
THESSRPLSVERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLE
EEEKRASKLPSKQRYVQEVIQRGRSCVRPACTPVLSVVPAVSDLELSETETKSQRKAGSG
GAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGHYRYYFKKVSDEFDCGV
VFEEVGEDEAVLPVFEEKIIGKVEKVD
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccctttggaccttggaacaactttcaccgaagatgcc
ccccgacccccagtgcctggtgaggagggtgaactggtgtccacagaccccaggcccgtc
agccacagcttctgctccgggaaaggtgtcggggttaaaggtgagacttcagcagccact
cccaggcgctcggatctggacctggggtacgagcctgagggcagcgcctcacccacccca
ccgtacttgaagtgggccgagtcactgcactccttactggacgatcaagacgggataaac
ctgtttcggactttcctgaagcaggaggactgtgctgacctgctggacttctggtttgcc
tgcagcggcttcaggaaactggagccctgtgactcaaatgaggagaagaggctgaagctg
gccaaagccatctaccgcaagtatatcctcgataacaacggcattgtgtccaggcagact
aagccggctaccaagagcttcataaaggactgcatcatgaagcagctcatcgatcctgcc
atgtttgaccaggcccagacggaaatccagtccaccatggaagaaaacacctacccctct
ttcctcaagtctgatatttatttggaatatacgaggacaggctccgagagcccgaagctc
tgtagtgaccagagctctgggtcagggacagggaagggcgtacctggatatctgcccact
ctgaacgaagatgaggaatggaagtgtgatcaagaccaagacgaagacggtggcagagac
cctgctccccccggcaggctcacacagaagctgcttctggagacggccgccccgcgggcc
tccgcaagtagacggtacagcgaaggaagagaattcaggtgcgggtcctggcgggagcct
gtccacccctactatgtcagctccggctacgccctggccccggctacgagcgccaacgac
agcgagcagcagagcctgtccagcgacgcggacagcctgtccctcaccgacagcagcgtg
gacggaatcccaccgtacaggatccgcaagcagcaccgccgggagatgcaggagagcgtc
caggtcaacgggcgggggtctctacctcacattcctcgcacttaccgaatgccaaaggag
atccgtgtggagccccagaagttcgccgcggagctcatccaccgcctggaggccattcag
cggacacgggaggccgaggagaagctggaggagcggctgaaacgcgtccggatggaggaa
gaaggcgaggatggtgacctgccctccggcccccccggggccagtcataagctgcctttg
gcccccgcctggcaccacttcccaccccgctatgcagacgtgggctgcatggcgctgcgg
gacgcgcacgaggagaaccccgagagcatcctggatgagcacgtgcagcgggtcatgagg
acgcctggctgtcagtcaccggggcccggccaccgttcccccgacagtgcgcacgtgccc
aagatcgtgggggtgctggggggcgtgccctctgggcatggtaagcacgcacccaagtcg
ggggcgaagctggacacggctggcctgcacctccacaggcacggccaccaccacggtcac
cacagtgctgccaggcccaaggagcaggccgatgctgaggctgcccgccgggtgcagggc
agcttcgcctggggcccggagctgcacggccacgcggccaagccccgcagccactcggag
agcgcgggtgccgcccccaatgccagcgacagcctggcctacagcgggaaggctggcact
gcctctagaagaaatgccaagaagaccgagtcggggaagaatgctggcactgaggtgcca
ggcccgtcggaggacacggagaagaaccaaaagatcctgcagtggatcatggagggggag
aaggagatcagccggcaccgcaaggccggccacgggtcttccggcgccaagaagcagcag
acgcacgagagctccaggcccttgtctgtcgagcgtcctggggccgtgcacccttgggtc
agtgctcagctccggaactccgtccagccctcccatctcttcattcaagaccccaccatg
ccccccaacccggcccccaacccactgacccagctggaggaggcccgcaggcgtctggag
gaggaggagaagagagccagcaagttaccctcaaagcagaggtatgtgcaggaggtcatc
cagcgggggcgctcctgcgtcaggccagcgtgcacacctgtgctgagcgtggtgccggcc
gtgtcggacttggagctctccgagacagagacgaagtcccagaggaaggcaggcagtggg
ggcgcccagccgtgcgacagcatcgtggtggcctactacttctgcggggagcccatcccc
tacaggaccctggtgcggggccgcgcggtcaccctgggccagttcaaggagttgctgacc
aagaagggccactacaggtattacttcaagaaggtgagcgacgagtttgactgcggagtg
gtgtttgaggaggttggggaagacgaggccgtcctgcctgtctttgaggagaagatcatt
ggcaaggtggagaaggtggactga

KEGG   Ailuropoda melanoleuca (giant panda): 100477069
Entry
100477069         CDS       T01329                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100477069 (AXIN2)
   04390 Hippo signaling pathway
    100477069 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100477069 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477069 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100477069 (AXIN2)
   05225 Hepatocellular carcinoma
    100477069 (AXIN2)
   05226 Gastric cancer
    100477069 (AXIN2)
   05217 Basal cell carcinoma
    100477069 (AXIN2)
   05213 Endometrial cancer
    100477069 (AXIN2)
   05224 Breast cancer
    100477069 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100477069 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100477069 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100477069 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100477069 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100477069 (AXIN2)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100477069 (AXIN2)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 100477069
NCBI-ProteinID: XP_034496484
Ensembl: ENSAMEG00000011884
LinkDB
Position
13
AA seq 842 aa
MSSAVLVTRLPDPSSSFHEDAPRPPVPGEEGETPPCQPGAGKGQVTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLERDKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLRVVCGYLPTLNEEEEWACADFK
CKLSPTVVGLSSKTLRATANVRTTEAVENGYRSFRRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEASELALSSREGGPTP
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHRHQQYHPL
LPPGGKLPPAAASQPGCPLLGAKGFVTKQTTKHVHHHYIHHHALPKSKEEMEAEAARQVR
CFCPGAAEYYCYSKCRSHLKALEPGPAEQFGSRGSTLPEPSGRSVEPGLALPAREGGAPG
GAGALQLPGEEGDRSQDVWQWMLESERQSKPKPPSAQSTKKAYPLESSRAFPAERAGRHP
LLGGSSGHPRAAARAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCAAGQQ
RDRNHPAAGQTGGAPFSSPSLASEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRML
KAHSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDEAVLPMYEGRILGKVER
ID
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgagcagtgctgtgttggtgacccggctcccagaccccagcagcagcttccacgaggat
gccccccgacccccagtgccgggggaagaaggggagaccccgccgtgccagcccggggca
ggaaagggccaggtcaccaaacccatgcctgtctcctccaacgccaggcggaatgaggat
gggttgggggagcccgaggggcgggcgtccccggattcccctctgaccaggtggaccaag
tccttgcactccttgttgggcgatcaagatggtgcttatctcttccgcactttcctggag
agggacaaatgtgtggataccttagacttctggtttgcctgcaatgggttcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcatcgtctccaagcagctgaaacctgccaccaaaacctacataagagatggc
atcaagaagcaacagattgattccatcatgtttgaccaggcacagactgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaatgggggactggggagcctcagggtt
gtgtgtggctatctccccaccttgaacgaggaagaggagtgggcttgtgctgacttcaag
tgcaaactgtcacccactgtggttggcttgtccagcaaaactctgagggctacagcgaac
gtgaggaccaccgaggctgttgaaaatggatacaggtccttcaggaggagcgatcccgtg
aatccataccacgtcggttctggctatgtcttcgcgccggctaccagcgccaacgacagt
gagatatccagcgacgcgctgactgacgattccatgtccatgacggacagcagcgtagat
ggaatccctccttatcgtgtggggagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaggtgtcgctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggagcctgccaccttcgcggcggagctcatctccaggctggagaag
ctgaagttggagctggagagccgccacagcctggaggagcgcctacagcagatccgagag
gatgaagagaaggaggcctccgagctagcactgagctccagggagggggggcccacgccg
caccccctctccctcctgccctccggcagctatgaggaggacccacagaccattctggac
gaccacctgtctagggtcctcaagacccccggctgccagtcgcccggcgtgggccgctac
agcccccgctcccgttcccccgaccaccaccaccaccgccaccagcagtaccaccccctg
ctcccacctgggggcaagctgccccccgcggccgcctcgcagcccgggtgccccctcctc
ggagccaagggcttcgtgaccaagcagacaacaaagcacgtccaccaccactacatccac
caccacgccctccccaagagcaaggaggagatggaggcagaggccgcgcggcaggtgcgc
tgcttctgccccggggccgccgagtattactgctactccaagtgcaggagccacctcaag
gccctggagcccgggccggccgagcagtttggcagcagaggcagtaccctgcccgagcca
agtgggagaagcgtggagccgggcctggccctgcccgccagggaaggaggggcccccggc
ggagctggggcgctgcagcttcccggggaggaaggagacaggtcgcaggatgtgtggcag
tggatgctggagagtgagcggcagagcaaacccaagccccctagtgcccaaagcacaaaa
aaggcttaccccttggagtccagccgtgcgttccccgccgagcgagccggccggcacccc
ctgctggggggcagcagcgggcacccccgcgctgccgcccgagcccacccgttcacccag
gaccccgcgatgcctcccctgaccccgcccaacactctggcacagctagaggaggcctgc
cgccggctggctgaggtgtccaagcccccaaagcagcggtgctgtgcagccggtcagcag
agggacaggaaccacccggctgctggtcagacaggaggcgcgcccttctccagccccagc
ctggcttccgaagatcacaaagagccgaagaagctggcgggggtccacgcgctccaggcc
agtgagttggtcgtcacgtactttttctgtggagaagaaatcccttacaggaggatgctg
aaggctcacagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaattat
aggtattacttcaaaaaagcaagtgacgagtttgcctgcggagccgtgtttgaggagatc
tgggacgatgaggcagtgctccccatgtacgaaggcaggattctggggaaggtggagagg
atcgactga

DBGET integrated database retrieval system