KEGG   Ailuropoda melanoleuca (giant panda): 100473290Help
Entry
100473290         CDS       T01329                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00020  Citrate cycle (TCA cycle)
aml00190  Oxidative phosphorylation
aml01100  Metabolic pathways
aml01200  Carbon metabolism
aml04714  Thermogenesis
aml04932  Non-alcoholic fatty liver disease (NAFLD)
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100473290 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100473290 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100473290 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100473290 (SDHB)
   05012 Parkinson disease
    100473290 (SDHB)
   05016 Huntington disease
    100473290 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100473290 (SDHB)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100473290 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 100473290
NCBI-ProteinID: XP_002924062
Ensembl: ENSAMEG00000000538
UniProt: G1L146
LinkDB All DBs
Position
Un
AA seq 277 aa AA seqDB search
MAAVAGVSLKRWFPVGGACLQACRGVQTAAATAPRIKKFAIYRWDPDKTGDKPHMQTYEI
DLNKCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNK
VSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKLDGL
YECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRC
HTIMNCTRTCPKGLNPGKAIAEIKKMMATYTGKKASV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggccggagtctccttgaagcgctggttccccgttggcggagcctgcctg
caggcctgccggggagtgcagacagctgccgccacagctccccgaatcaagaaatttgcc
atctaccgatgggacccagacaagactggagataaacctcatatgcagacttatgaaatt
gatttgaataaatgtggacctatggtgttggatgctttaatcaagattaagaatgaaatg
gattctaccttgaccttccgaagatcatgcagagaaggtatatgtggctcttgtgccatg
aacatcaacggaggcaacactctggcttgcacccgaaggatcgacaccaacctcaacaaa
gtctccaaaatctaccctcttccgcatatgtatgtgataaaggatcttgttcccgacttg
agcaacttctacgctcagtacaaatccattgaaccttatttgaagaagaaggacgaatcc
caggagggcaagcagcagtatctgcagtccatagaagaccgtgagaaactggacgggctg
tacgagtgtatcctctgtgcctgctgcagcaccagctgcccgagctactggtggaacgga
gacaaatacctggggcctgccgttcttatgcaggcgtaccgctggatgattgactcgaga
gatgacttcacggaggagcgcctggccaagctgcaggacccgttctccctgtaccgctgc
cataccatcatgaactgcaccaggacctgccccaaggggctgaatccaggcaaagctatt
gctgaaatcaagaaaatgatggccacctacacggggaagaaagcgtctgtgtaa

DBGET integrated database retrieval system